Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6005
Gene name Gene Name - the full gene name approved by the HGNC.	Rh associated glycoprotein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RHAG
Synonyms (NCBI Gene) Gene synonyms aliases	CD241, OHS, OHST, RH2, RH50A, RHNR, Rh50, Rh50GP, SLC42A1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p12.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is erythrocyte-specific and is thought to be part of a membrane channel that transports ammonium and carbon dioxide across the blood cell membrane. The encoded protein appears to interact with Rh blood group antigens and R

Show/Hide all(14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs16879498	C>T	Pathogenic, benign	Missense variant, genic downstream transcript variant, coding sequence variant
rs104893987	C>T	Pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant
rs121918586	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs121918587	C>T	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs121918588	C>A	Pathogenic	Initiator codon variant, missense variant
rs121918589	C>A,T	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs375508949	C>T	Pathogenic	Splice donor variant
rs387906519	GAGG>TC	Pathogenic	Frameshift variant, coding sequence variant
rs863225468	A>G	Pathogenic	Coding sequence variant, missense variant
rs863225469	A>C	Pathogenic	Coding sequence variant, missense variant
rs1554174425	A>C,G	Pathogenic	Missense variant, coding sequence variant, synonymous variant
rs1562011389	T>-	Pathogenic	Genic downstream transcript variant, coding sequence variant, frameshift variant
rs1562012617	C>T	Pathogenic	Splice donor variant, genic downstream transcript variant
rs1562012697	C>T	Pathogenic	Splice acceptor variant, genic downstream transcript variant

Show/Hide all(17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019341	hsa-miR-148b-3p	Microarray	17612493
MIRT053366	hsa-miR-9-5p	Microarray, qRT-PCR	23798388
MIRT1304646	hsa-miR-193a-3p	CLIP-seq
MIRT1304647	hsa-miR-193b	CLIP-seq
MIRT1304648	hsa-miR-3122	CLIP-seq
MIRT1304649	hsa-miR-3187-3p	CLIP-seq
MIRT1304650	hsa-miR-3913-5p	CLIP-seq
MIRT1304651	hsa-miR-4529-5p	CLIP-seq
MIRT1304652	hsa-miR-4668-3p	CLIP-seq
MIRT2315027	hsa-miR-1253	CLIP-seq
MIRT1304648	hsa-miR-3122	CLIP-seq
MIRT2315028	hsa-miR-3690	CLIP-seq
MIRT1304650	hsa-miR-3913-5p	CLIP-seq
MIRT2315029	hsa-miR-4254	CLIP-seq
MIRT2315030	hsa-miR-4434	CLIP-seq
MIRT2315031	hsa-miR-4516	CLIP-seq
MIRT2315032	hsa-miR-4531	CLIP-seq

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15929723, 27247322
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1417776
GO:0006873	Process	Intracellular monoatomic ion homeostasis	IDA	15856280
GO:0008519	Function	Ammonium channel activity	IBA
GO:0008519	Function	Ammonium channel activity	IDA	15856280, 15929723, 16866382, 17712059, 19273840, 24077989, 26354748
GO:0008519	Function	Ammonium channel activity	IEA
GO:0008519	Function	Ammonium channel activity	IGI	11062476
GO:0008519	Function	Ammonium channel activity	TAS
GO:0015200	Function	Methylammonium transmembrane transporter activity	IDA	15856280
GO:0015200	Function	Methylammonium transmembrane transporter activity	IEA
GO:0015670	Process	Carbon dioxide transport	IDA	16574458, 17712059, 19273840, 24077989
GO:0015701	Process	Bicarbonate transport	TAS
GO:0016020	Component	Membrane	IDA	22012326
GO:0016020	Component	Membrane	IEA
GO:0022840	Function	Leak channel activity	IDA	18931342
GO:0030506	Function	Ankyrin binding	IEA
GO:0030506	Function	Ankyrin binding	IPI	12719424, 16580865
GO:0035378	Process	Carbon dioxide transmembrane transport	IDA	19273840
GO:0035379	Function	Carbon dioxide transmembrane transporter activity	IDA	19273840, 24077989
GO:0035379	Function	Carbon dioxide transmembrane transporter activity	IEA
GO:0035379	Function	Carbon dioxide transmembrane transporter activity	TAS
GO:0048821	Process	Erythrocyte development	IEA
GO:0060586	Process	Multicellular organismal-level iron ion homeostasis	IEA
GO:0072488	Process	Ammonium transmembrane transport	IBA
GO:0072488	Process	Ammonium transmembrane transport	IDA	11861637, 15856280, 15929723, 16574458, 16866382, 17712059, 19273840, 24077989, 26354748
GO:0072488	Process	Ammonium transmembrane transport	IEA
GO:0072488	Process	Ammonium transmembrane transport	IEA
GO:0072488	Process	Ammonium transmembrane transport	IGI	11062476
GO:0072488	Process	Ammonium transmembrane transport	IMP	22012326
GO:0072489	Process	Methylammonium transmembrane transport	IDA	15856280
GO:0072489	Process	Methylammonium transmembrane transport	IEA
GO:0097272	Process	Ammonium homeostasis	IBA
GO:0098662	Process	Inorganic cation transmembrane transport	IDA	18931342
GO:0170014	Component	Ankyrin-1 complex	IDA	35835865

MIM	HGNC	e!Ensembl
180297	10006	ENSG00000112077

Protein

UniProt ID

Q02094

Protein name

Ammonium transporter Rh type A (Erythrocyte membrane glycoprotein Rh50) (Erythrocyte plasma membrane 50 kDa glycoprotein) (Rh50A) (Rhesus blood group family type A glycoprotein) (Rh family type A glycoprotein) (Rh type A glycoprotein) (Rhesus blood group-

Protein function

Component of the ankyrin-1 complex, a multiprotein complex involved in the stability and shape of the erythrocyte membrane (PubMed:35835865). Heterotrimer with RHCE (RHAG)2(RHCE), that transports ammonium and its related derivative methylammoniu

PDB

7UZQ , 7V0K , 7V0S , 8CRT , 8CS9 , 8CSL , 8CSX , 8CTE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00909	Ammonium_transp	15 → 402	Ammonium Transporter Family	Family

Tissue specificity

TISSUE SPECIFICITY: Erythrocytes. {ECO:0000269|PubMed:18931342, ECO:0000269|PubMed:22012326, ECO:0000269|PubMed:9473510}.

Sequence

MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVM
IFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADF
SAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAY
FGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAI
VNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIG
SIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVAMGASNTSMAM
QAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR

Sequence length

409

Interactions

View interactions

	Reactome
			Erythrocytes take up carbon dioxide and release oxygen Erythrocytes take up oxygen and release carbon dioxide Rhesus glycoproteins mediate ammonium transport. Defective RHAG causes regulator type Rh-null hemolytic anemia (RHN)

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Overhydrated Hereditary Stomatocytosis	overhydrated hereditary stomatocytosis	rs863225469, rs1554174425, rs121918587, rs863225468	N/A

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Anemia Hemolytic	Associate	21859730, 9442063
Cardiac Arrhythmia Ankyrin B Related	Associate	27247322
Colorectal Neoplasms	Associate	21194832
Colorectal Neoplasms	Inhibit	36916297
Disease	Associate	9442063, 9657769
Elliptocytosis 1	Associate	9442063
Hypertension	Associate	10467273
Leukemia	Associate	24606425
Neoplasms	Inhibit	21194832, 24606425
Neoplasms	Associate	31526853
Ovarian Neoplasms	Associate	32629664
Protein Deficiency	Associate	20179084
Red Cell Aplasia Pure	Associate	21859730
Rh Deficiency Syndrome	Associate	9746795
Rh Null Regulator Type	Associate	10467273, 23417980, 9442063
Spherocytosis Hereditary	Associate	20179084, 27247322
Stomatocytosis I	Associate	21849667, 21859730, 38087905

RHAG (Rh associated glycoprotein)