RGS13 (regulator of G protein signaling 13)

Gene

• Entrez ID: 6003
• Gene name: Regulator of G protein signaling 13
• Gene symbol: RGS13
• Synonyms (NCBI Gene): -
• Chromosome: 1
• Chromosome location: 1q31.2
• Summary: The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS protein

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018349	hsa-miR-335-5p	Microarray	18185580
MIRT021238	hsa-miR-146a-5p	Microarray	18057241
MIRT1304132	hsa-miR-3185	CLIP-seq
MIRT1304133	hsa-miR-335	CLIP-seq
MIRT1304134	hsa-miR-3646	CLIP-seq
MIRT1304135	hsa-miR-4696	CLIP-seq
MIRT2090122	hsa-miR-3914	CLIP-seq
MIRT2090123	hsa-miR-4307	CLIP-seq
MIRT2090124	hsa-miR-548n	CLIP-seq
MIRT2090125	hsa-miR-548t	CLIP-seq
MIRT2090126	hsa-miR-651	CLIP-seq
MIRT2611193	hsa-miR-1297	CLIP-seq
MIRT2611194	hsa-miR-1303	CLIP-seq
MIRT2611195	hsa-miR-26a	CLIP-seq
MIRT2611196	hsa-miR-26b	CLIP-seq
MIRT2611197	hsa-miR-4465	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IEA

Other IDs

• MIM: 607190
• HGNC: 9995
• e!Ensembl: ENSG00000127074

Protein

• UniProt ID: O14921
• Protein name: Regulator of G-protein signaling 13 (RGS13)
• Protein function: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to both G(i)-alpha and G(q)-alpha (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00615	RGS	34 → 149	Regulator of G protein signaling domain	Domain

• Sequence:

  MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDEN
  IQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETC
  FEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF

• Sequence length: 159

Pathways

Reactome:

G alpha (q) signalling events
G alpha (i) signalling events