RGS10 (regulator of G protein signaling 10)

Gene

• Entrez ID: 6001
• Gene name: Regulator of G protein signaling 10
• Gene symbol: RGS10
• Synonyms (NCBI Gene): -
• Chromosome: 10
• Chromosome location: 10q26.11
• Summary: Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alph

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1304072	hsa-miR-1200	CLIP-seq
MIRT1304073	hsa-miR-3121-5p	CLIP-seq
MIRT1304074	hsa-miR-3125	CLIP-seq
MIRT1304075	hsa-miR-3916	CLIP-seq
MIRT1304076	hsa-miR-3977	CLIP-seq
MIRT1304077	hsa-miR-4324	CLIP-seq
MIRT1304078	hsa-miR-544b	CLIP-seq
MIRT1304072	hsa-miR-1200	CLIP-seq
MIRT1304074	hsa-miR-3125	CLIP-seq
MIRT1304075	hsa-miR-3916	CLIP-seq
MIRT1304077	hsa-miR-4324	CLIP-seq
MIRT1304078	hsa-miR-544b	CLIP-seq
MIRT2090121	hsa-miR-564	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
DNMT1	Unknown	24475290
HDAC1	Unknown	24475290

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0001965	Function	G-protein alpha-subunit binding	IPI	18434541
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IDA	11443111, 18434541
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IDA	10791963, 11443111
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	11443111
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	IDA	11443111
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0043547	Process	Positive regulation of GTPase activity	IDA	18434541
GO:0045202	Component	Synapse	IEA

Other IDs

• MIM: 602856
• HGNC: 9992
• e!Ensembl: ENSG00000148908

Protein

• UniProt ID: O43665
• Protein name: Regulator of G-protein signaling 10 (RGS10)
• Protein function: Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the muscarinic acetylcholine receptor CHRM2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving t
• PDB: 2DLR, 2I59, 2IHB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00615	RGS	41 → 155	Regulator of G protein signaling domain	Domain

• Sequence:

  MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLK
  KEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILE
  EPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYN
  T

• Sequence length: 181

Pathways

Reactome:

G alpha (i) signalling events