Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6000
Gene name Gene Name - the full gene name approved by the HGNC.	Regulator of G protein signaling 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RGS7
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q43\|1q23.1

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments
MIRT1304542	hsa-miR-1	CLIP-seq
MIRT1304543	hsa-miR-206	CLIP-seq
MIRT1304544	hsa-miR-3166	CLIP-seq
MIRT1304545	hsa-miR-329	CLIP-seq
MIRT1304546	hsa-miR-362-3p	CLIP-seq
MIRT1304547	hsa-miR-3673	CLIP-seq
MIRT1304548	hsa-miR-3941	CLIP-seq
MIRT1304549	hsa-miR-4277	CLIP-seq
MIRT1304550	hsa-miR-4428	CLIP-seq
MIRT1304551	hsa-miR-4709-5p	CLIP-seq
MIRT1304552	hsa-miR-544	CLIP-seq
MIRT1304553	hsa-miR-582-5p	CLIP-seq
MIRT1304554	hsa-miR-603	CLIP-seq
MIRT1304555	hsa-miR-610	CLIP-seq
MIRT1304556	hsa-miR-613	CLIP-seq
MIRT2090232	hsa-miR-145	CLIP-seq
MIRT2090233	hsa-miR-3136-5p	CLIP-seq
MIRT2090234	hsa-miR-4328	CLIP-seq
MIRT2090235	hsa-miR-4439	CLIP-seq
MIRT2090236	hsa-miR-4513	CLIP-seq
MIRT2090237	hsa-miR-943	CLIP-seq
MIRT2090232	hsa-miR-145	CLIP-seq
MIRT2090233	hsa-miR-3136-5p	CLIP-seq
MIRT2090234	hsa-miR-4328	CLIP-seq
MIRT2090235	hsa-miR-4439	CLIP-seq
MIRT2090236	hsa-miR-4513	CLIP-seq
MIRT2090237	hsa-miR-943	CLIP-seq
MIRT2393691	hsa-miR-127-5p	CLIP-seq
MIRT2393692	hsa-miR-4711-3p	CLIP-seq
MIRT2458159	hsa-miR-3909	CLIP-seq
MIRT2458160	hsa-miR-767-3p	CLIP-seq

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IDA	36996198
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	10521509, 31189666, 36996198
GO:0005096	Function	GTPase activator activity	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	10521509
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10521509
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	31189666
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031681	Function	G-protein beta-subunit binding	IPI	19376773
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043547	Process	Positive regulation of GTPase activity	IDA	10521509
GO:0044292	Component	Dendrite terminus	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IDA	36996198
GO:0051286	Component	Cell tip	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

MIM	HGNC	e!Ensembl
602517	10003	ENSG00000182901

Protein

UniProt ID

P49802

Protein name

Regulator of G-protein signaling 7 (RGS7)

Protein function

GTPase activator component of the RGS7-GNB5 complex that regulates G protein-coupled receptor signaling cascades (PubMed:10521509, PubMed:10862767, PubMed:31189666). The RGS7-GNB5 complex acts as an inhibitor signal transduction by promoting the

PDB

2A72 , 2D9J , 7EWP , 7EWR , 7SHF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00610	DEP	40 → 110	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
PF18148	RGS_DHEX	113 → 214	Regulator of G-protein signalling DHEX domain	Domain
PF00631	G-gamma	252 → 316	GGL domain	Domain
PF00615	RGS	333 → 447	Regulator of G protein signaling domain	Domain

Sequence

MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
SPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLSYTEQYLEYDPFLLPP
DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
RFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKSGNSMDRRTSFEKFAQNVGRNIPIFPC
HKNCTPTLRASTNLL

Sequence length

495

Interactions

View interactions

	Reactome
			G alpha (i) signalling events Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Dementia	Dementia	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Mental Depression	Major depressive disorder	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Neurodevelopmental Disorders	neurodevelopmental disorder	N/A	N/A	GenCC
Prostate cancer	Prostate cancer, Prostate cancer (late onset)	N/A	N/A	GWAS

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	37761960
Carcinoma Non Small Cell Lung	Associate	21698121
Cerebral Infarction	Associate	27533483
Cognition Disorders	Associate	25712083
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	25712083
Hypertriglyceridemia	Associate	39662927
Inflammation	Associate	36999276
Melanoma	Associate	29330521
Neoplasms	Associate	23555580
Neoplasms	Inhibit	29330521
Neoplasms Adipose Tissue	Associate	17030972
Pancreatitis	Associate	36999276
Polycystic Kidney Autosomal Dominant	Associate	10339594
Uterine Cervical Neoplasms	Associate	37308506
Venous Thromboembolism	Associate	37308506

RGS7 (regulator of G protein signaling 7)