Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5997
Gene name Gene Name - the full gene name approved by the HGNC.	Regulator of G protein signaling 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RGS2
Synonyms (NCBI Gene) Gene synonyms aliases	G0S8
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q31.2
Summary Summary of gene provided in NCBI Entrez Gene.	Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alph

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs547204431	G>C,T	Likely-pathogenic	Splice donor variant

Show/Hide all(114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005903	hsa-miR-22-3p	Luciferase reporter assay, Microarray	21168126
MIRT005903	hsa-miR-22-3p	Luciferase reporter assay	23349832
MIRT1304335	hsa-miR-128	CLIP-seq
MIRT1304336	hsa-miR-3126-5p	CLIP-seq
MIRT1304337	hsa-miR-3140-3p	CLIP-seq
MIRT1304338	hsa-miR-3619-3p	CLIP-seq
MIRT1304339	hsa-miR-4272	CLIP-seq
MIRT1304340	hsa-miR-4419a	CLIP-seq
MIRT1304341	hsa-miR-4477a	CLIP-seq
MIRT1304342	hsa-miR-4510	CLIP-seq
MIRT1304343	hsa-miR-4520b-3p	CLIP-seq
MIRT1304344	hsa-miR-4529-3p	CLIP-seq
MIRT1304345	hsa-miR-4535	CLIP-seq
MIRT1304346	hsa-miR-4672	CLIP-seq
MIRT1304347	hsa-miR-4776-5p	CLIP-seq
MIRT1304348	hsa-miR-548l	CLIP-seq
MIRT1304349	hsa-miR-548n	CLIP-seq
MIRT1304350	hsa-miR-548t	CLIP-seq
MIRT2314912	hsa-miR-1200	CLIP-seq
MIRT2314913	hsa-miR-1207-5p	CLIP-seq
MIRT2314914	hsa-miR-1271	CLIP-seq
MIRT1304335	hsa-miR-128	CLIP-seq
MIRT2314915	hsa-miR-182	CLIP-seq
MIRT2314916	hsa-miR-191	CLIP-seq
MIRT2314917	hsa-miR-193a-3p	CLIP-seq
MIRT2314918	hsa-miR-193b	CLIP-seq
MIRT2314919	hsa-miR-223	CLIP-seq
MIRT2314920	hsa-miR-4279	CLIP-seq
MIRT2314921	hsa-miR-4736	CLIP-seq
MIRT2314922	hsa-miR-4763-3p	CLIP-seq
MIRT2314923	hsa-miR-516a-3p	CLIP-seq
MIRT2314924	hsa-miR-634	CLIP-seq
MIRT2314925	hsa-miR-892b	CLIP-seq
MIRT2314926	hsa-miR-935	CLIP-seq
MIRT2314927	hsa-miR-96	CLIP-seq
MIRT2439900	hsa-miR-377	CLIP-seq
MIRT2442553	hsa-miR-101	CLIP-seq
MIRT2442554	hsa-miR-1278	CLIP-seq
MIRT2442555	hsa-miR-3682-3p	CLIP-seq
MIRT2442556	hsa-miR-4502	CLIP-seq
MIRT2442557	hsa-miR-4709-5p	CLIP-seq
MIRT2442553	hsa-miR-101	CLIP-seq
MIRT2611219	hsa-miR-1179	CLIP-seq
MIRT2314912	hsa-miR-1200	CLIP-seq
MIRT2442554	hsa-miR-1278	CLIP-seq
MIRT2314917	hsa-miR-193a-3p	CLIP-seq
MIRT2314918	hsa-miR-193b	CLIP-seq
MIRT2314919	hsa-miR-223	CLIP-seq
MIRT2611220	hsa-miR-3074-5p	CLIP-seq
MIRT2611221	hsa-miR-3140-5p	CLIP-seq
MIRT2611222	hsa-miR-3168	CLIP-seq
MIRT1304338	hsa-miR-3619-3p	CLIP-seq
MIRT2442555	hsa-miR-3682-3p	CLIP-seq
MIRT2439900	hsa-miR-377	CLIP-seq
MIRT2611223	hsa-miR-3929	CLIP-seq
MIRT2611224	hsa-miR-3974	CLIP-seq
MIRT2314920	hsa-miR-4279	CLIP-seq
MIRT2611225	hsa-miR-4303	CLIP-seq
MIRT2611226	hsa-miR-4419b	CLIP-seq
MIRT2611227	hsa-miR-4452	CLIP-seq
MIRT2611228	hsa-miR-4478	CLIP-seq
MIRT2442556	hsa-miR-4502	CLIP-seq
MIRT2611229	hsa-miR-4511	CLIP-seq
MIRT2611230	hsa-miR-4666-5p	CLIP-seq
MIRT2611231	hsa-miR-4680-3p	CLIP-seq
MIRT2611232	hsa-miR-4682	CLIP-seq
MIRT2442557	hsa-miR-4709-5p	CLIP-seq
MIRT2611233	hsa-miR-4761-5p	CLIP-seq
MIRT2611234	hsa-miR-4765	CLIP-seq
MIRT2314923	hsa-miR-516a-3p	CLIP-seq
MIRT2611235	hsa-miR-548b-3p	CLIP-seq
MIRT2611236	hsa-miR-622	CLIP-seq
MIRT2314924	hsa-miR-634	CLIP-seq
MIRT2314925	hsa-miR-892b	CLIP-seq
MIRT2314926	hsa-miR-935	CLIP-seq
MIRT2442553	hsa-miR-101	CLIP-seq
MIRT2611219	hsa-miR-1179	CLIP-seq
MIRT2442554	hsa-miR-1278	CLIP-seq
MIRT2689726	hsa-miR-144	CLIP-seq
MIRT2314917	hsa-miR-193a-3p	CLIP-seq
MIRT2314918	hsa-miR-193b	CLIP-seq
MIRT2314919	hsa-miR-223	CLIP-seq
MIRT2689727	hsa-miR-2909	CLIP-seq
MIRT2689728	hsa-miR-299-3p	CLIP-seq
MIRT1304337	hsa-miR-3140-3p	CLIP-seq
MIRT2689729	hsa-miR-3153	CLIP-seq
MIRT2689730	hsa-miR-3162-5p	CLIP-seq
MIRT1304338	hsa-miR-3619-3p	CLIP-seq
MIRT2442555	hsa-miR-3682-3p	CLIP-seq
MIRT2439900	hsa-miR-377	CLIP-seq
MIRT2314920	hsa-miR-4279	CLIP-seq
MIRT2689731	hsa-miR-4491	CLIP-seq
MIRT2442556	hsa-miR-4502	CLIP-seq
MIRT2611229	hsa-miR-4511	CLIP-seq
MIRT1304343	hsa-miR-4520b-3p	CLIP-seq
MIRT1304344	hsa-miR-4529-3p	CLIP-seq
MIRT1304345	hsa-miR-4535	CLIP-seq
MIRT2689732	hsa-miR-4536	CLIP-seq
MIRT2689733	hsa-miR-4657	CLIP-seq
MIRT2611230	hsa-miR-4666-5p	CLIP-seq
MIRT2442557	hsa-miR-4709-5p	CLIP-seq
MIRT2689734	hsa-miR-4753-5p	CLIP-seq
MIRT1304347	hsa-miR-4776-5p	CLIP-seq
MIRT2689735	hsa-miR-4802-3p	CLIP-seq
MIRT2689736	hsa-miR-490-5p	CLIP-seq
MIRT2689737	hsa-miR-548a-3p	CLIP-seq
MIRT2611235	hsa-miR-548b-3p	CLIP-seq
MIRT2689738	hsa-miR-548e	CLIP-seq
MIRT2689739	hsa-miR-548f	CLIP-seq
MIRT2689740	hsa-miR-593	CLIP-seq
MIRT2689741	hsa-miR-606	CLIP-seq
MIRT2314924	hsa-miR-634	CLIP-seq
MIRT2314925	hsa-miR-892b	CLIP-seq
MIRT2314926	hsa-miR-935	CLIP-seq

Show/Hide all(53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IPI	19478087
GO:0001975	Process	Response to amphetamine	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	IMP	19478087
GO:0005096	Function	GTPase activator activity	TAS	10747990
GO:0005515	Function	Protein binding	IPI	14608379, 17464283, 23434405, 24794857, 25416956, 25766235, 25910212, 32296183, 32814053
GO:0005516	Function	Calmodulin binding	TAS	10747990
GO:0005634	Component	Nucleus	IDA	10791963, 11278586
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	11278586
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005886	Component	Plasma membrane	IDA	11278586
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006417	Process	Regulation of translation	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007283	Process	Spermatogenesis	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	10747990
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	IEA
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	ISS
GO:0010855	Function	Adenylate cyclase inhibitor activity	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0016020	Component	Membrane	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	ISS
GO:0046329	Process	Negative regulation of JNK cascade	IEA
GO:0046329	Process	Negative regulation of JNK cascade	ISS
GO:0048487	Function	Beta-tubulin binding	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0055119	Process	Relaxation of cardiac muscle	IEA
GO:0055119	Process	Relaxation of cardiac muscle	ISS
GO:0060087	Process	Relaxation of vascular associated smooth muscle	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0060452	Process	Positive regulation of cardiac muscle contraction	IEA
GO:0060452	Process	Positive regulation of cardiac muscle contraction	ISS
GO:0061052	Process	Negative regulation of cell growth involved in cardiac muscle cell development	IEA
GO:0071877	Process	Regulation of adenylate cyclase-inhibiting adrenergic receptor signaling pathway	IEA
GO:0071877	Process	Regulation of adenylate cyclase-inhibiting adrenergic receptor signaling pathway	ISS
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:1900924	Process	Negative regulation of glycine import across plasma membrane	IEA

MIM	HGNC	e!Ensembl
600861	9998	ENSG00000116741

Protein

UniProt ID

P41220

Protein name

Regulator of G-protein signaling 2 (RGS2) (Cell growth-inhibiting gene 31 protein) (G0/G1 switch regulatory protein 8)

Protein function

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:11063746, PubMed:19478087). It i

PDB

2AF0 , 2V4Z , 4EKC , 4EKD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00615	RGS	83 → 198	Regulator of G protein signaling domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in acute myelogenous leukemia (AML) and in acute lymphoblastic leukemia (ALL). {ECO:0000269|PubMed:7643615}.

Sequence

MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT

Sequence length

211

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway Olfactory transduction Oxytocin signaling pathway		G alpha (q) signalling events

RGS2 (regulator of G protein signaling 2)