Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5997
Gene name	Regulator of G protein signaling 2
Gene symbol	RGS2
Synonyms (NCBI Gene)	G0S8
Chromosome	1
Chromosome location	1q31.2
Summary	Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alph

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs547204431	G>C,T	Likely-pathogenic	Splice donor variant

114

Show/Hide all (114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005903	hsa-miR-22-3p	Luciferase reporter assayMicroarray	21168126
MIRT005903	hsa-miR-22-3p	Luciferase reporter assay	23349832
MIRT1304335	hsa-miR-128	CLIP-seq
MIRT1304336	hsa-miR-3126-5p	CLIP-seq
MIRT1304337	hsa-miR-3140-3p	CLIP-seq
MIRT1304338	hsa-miR-3619-3p	CLIP-seq
MIRT1304339	hsa-miR-4272	CLIP-seq
MIRT1304340	hsa-miR-4419a	CLIP-seq
MIRT1304341	hsa-miR-4477a	CLIP-seq
MIRT1304342	hsa-miR-4510	CLIP-seq
MIRT1304343	hsa-miR-4520b-3p	CLIP-seq
MIRT1304344	hsa-miR-4529-3p	CLIP-seq
MIRT1304345	hsa-miR-4535	CLIP-seq
MIRT1304346	hsa-miR-4672	CLIP-seq
MIRT1304347	hsa-miR-4776-5p	CLIP-seq
MIRT1304348	hsa-miR-548l	CLIP-seq
MIRT1304349	hsa-miR-548n	CLIP-seq
MIRT1304350	hsa-miR-548t	CLIP-seq
MIRT2314912	hsa-miR-1200	CLIP-seq
MIRT2314913	hsa-miR-1207-5p	CLIP-seq
MIRT2314914	hsa-miR-1271	CLIP-seq
MIRT1304335	hsa-miR-128	CLIP-seq
MIRT2314915	hsa-miR-182	CLIP-seq
MIRT2314916	hsa-miR-191	CLIP-seq
MIRT2314917	hsa-miR-193a-3p	CLIP-seq
MIRT2314918	hsa-miR-193b	CLIP-seq
MIRT2314919	hsa-miR-223	CLIP-seq
MIRT2314920	hsa-miR-4279	CLIP-seq
MIRT2314921	hsa-miR-4736	CLIP-seq
MIRT2314922	hsa-miR-4763-3p	CLIP-seq
MIRT2314923	hsa-miR-516a-3p	CLIP-seq
MIRT2314924	hsa-miR-634	CLIP-seq
MIRT2314925	hsa-miR-892b	CLIP-seq
MIRT2314926	hsa-miR-935	CLIP-seq
MIRT2314927	hsa-miR-96	CLIP-seq
MIRT2439900	hsa-miR-377	CLIP-seq
MIRT2442553	hsa-miR-101	CLIP-seq
MIRT2442554	hsa-miR-1278	CLIP-seq
MIRT2442555	hsa-miR-3682-3p	CLIP-seq
MIRT2442556	hsa-miR-4502	CLIP-seq
MIRT2442557	hsa-miR-4709-5p	CLIP-seq
MIRT2442553	hsa-miR-101	CLIP-seq
MIRT2611219	hsa-miR-1179	CLIP-seq
MIRT2314912	hsa-miR-1200	CLIP-seq
MIRT2442554	hsa-miR-1278	CLIP-seq
MIRT2314917	hsa-miR-193a-3p	CLIP-seq
MIRT2314918	hsa-miR-193b	CLIP-seq
MIRT2314919	hsa-miR-223	CLIP-seq
MIRT2611220	hsa-miR-3074-5p	CLIP-seq
MIRT2611221	hsa-miR-3140-5p	CLIP-seq
MIRT2611222	hsa-miR-3168	CLIP-seq
MIRT1304338	hsa-miR-3619-3p	CLIP-seq
MIRT2442555	hsa-miR-3682-3p	CLIP-seq
MIRT2439900	hsa-miR-377	CLIP-seq
MIRT2611223	hsa-miR-3929	CLIP-seq
MIRT2611224	hsa-miR-3974	CLIP-seq
MIRT2314920	hsa-miR-4279	CLIP-seq
MIRT2611225	hsa-miR-4303	CLIP-seq
MIRT2611226	hsa-miR-4419b	CLIP-seq
MIRT2611227	hsa-miR-4452	CLIP-seq
MIRT2611228	hsa-miR-4478	CLIP-seq
MIRT2442556	hsa-miR-4502	CLIP-seq
MIRT2611229	hsa-miR-4511	CLIP-seq
MIRT2611230	hsa-miR-4666-5p	CLIP-seq
MIRT2611231	hsa-miR-4680-3p	CLIP-seq
MIRT2611232	hsa-miR-4682	CLIP-seq
MIRT2442557	hsa-miR-4709-5p	CLIP-seq
MIRT2611233	hsa-miR-4761-5p	CLIP-seq
MIRT2611234	hsa-miR-4765	CLIP-seq
MIRT2314923	hsa-miR-516a-3p	CLIP-seq
MIRT2611235	hsa-miR-548b-3p	CLIP-seq
MIRT2611236	hsa-miR-622	CLIP-seq
MIRT2314924	hsa-miR-634	CLIP-seq
MIRT2314925	hsa-miR-892b	CLIP-seq
MIRT2314926	hsa-miR-935	CLIP-seq
MIRT2442553	hsa-miR-101	CLIP-seq
MIRT2611219	hsa-miR-1179	CLIP-seq
MIRT2442554	hsa-miR-1278	CLIP-seq
MIRT2689726	hsa-miR-144	CLIP-seq
MIRT2314917	hsa-miR-193a-3p	CLIP-seq
MIRT2314918	hsa-miR-193b	CLIP-seq
MIRT2314919	hsa-miR-223	CLIP-seq
MIRT2689727	hsa-miR-2909	CLIP-seq
MIRT2689728	hsa-miR-299-3p	CLIP-seq
MIRT1304337	hsa-miR-3140-3p	CLIP-seq
MIRT2689729	hsa-miR-3153	CLIP-seq
MIRT2689730	hsa-miR-3162-5p	CLIP-seq
MIRT1304338	hsa-miR-3619-3p	CLIP-seq
MIRT2442555	hsa-miR-3682-3p	CLIP-seq
MIRT2439900	hsa-miR-377	CLIP-seq
MIRT2314920	hsa-miR-4279	CLIP-seq
MIRT2689731	hsa-miR-4491	CLIP-seq
MIRT2442556	hsa-miR-4502	CLIP-seq
MIRT2611229	hsa-miR-4511	CLIP-seq
MIRT1304343	hsa-miR-4520b-3p	CLIP-seq
MIRT1304344	hsa-miR-4529-3p	CLIP-seq
MIRT1304345	hsa-miR-4535	CLIP-seq
MIRT2689732	hsa-miR-4536	CLIP-seq
MIRT2689733	hsa-miR-4657	CLIP-seq
MIRT2611230	hsa-miR-4666-5p	CLIP-seq
MIRT2442557	hsa-miR-4709-5p	CLIP-seq
MIRT2689734	hsa-miR-4753-5p	CLIP-seq
MIRT1304347	hsa-miR-4776-5p	CLIP-seq
MIRT2689735	hsa-miR-4802-3p	CLIP-seq
MIRT2689736	hsa-miR-490-5p	CLIP-seq
MIRT2689737	hsa-miR-548a-3p	CLIP-seq
MIRT2611235	hsa-miR-548b-3p	CLIP-seq
MIRT2689738	hsa-miR-548e	CLIP-seq
MIRT2689739	hsa-miR-548f	CLIP-seq
MIRT2689740	hsa-miR-593	CLIP-seq
MIRT2689741	hsa-miR-606	CLIP-seq
MIRT2314924	hsa-miR-634	CLIP-seq
MIRT2314925	hsa-miR-892b	CLIP-seq
MIRT2314926	hsa-miR-935	CLIP-seq

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IPI	19478087
GO:0001975	Process	Response to amphetamine	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	IMP	19478087
GO:0005096	Function	GTPase activator activity	TAS	10747990
GO:0005515	Function	Protein binding	IPI	14608379, 17464283, 23434405, 24794857, 25416956, 25766235, 25910212, 32296183, 32814053
GO:0005516	Function	Calmodulin binding	TAS	10747990
GO:0005634	Component	Nucleus	IDA	10791963, 11278586
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	11278586
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005886	Component	Plasma membrane	IDA	11278586
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006417	Process	Regulation of translation	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007283	Process	Spermatogenesis	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	10747990
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	IEA
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	ISS
GO:0010855	Function	Adenylate cyclase inhibitor activity	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0016020	Component	Membrane	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	ISS
GO:0046329	Process	Negative regulation of JNK cascade	IEA
GO:0046329	Process	Negative regulation of JNK cascade	ISS
GO:0048487	Function	Beta-tubulin binding	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0055119	Process	Relaxation of cardiac muscle	IEA
GO:0055119	Process	Relaxation of cardiac muscle	ISS
GO:0060087	Process	Relaxation of vascular associated smooth muscle	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0060452	Process	Positive regulation of cardiac muscle contraction	IEA
GO:0060452	Process	Positive regulation of cardiac muscle contraction	ISS
GO:0061052	Process	Negative regulation of cell growth involved in cardiac muscle cell development	IEA
GO:0071877	Process	Regulation of adenylate cyclase-inhibiting adrenergic receptor signaling pathway	IEA
GO:0071877	Process	Regulation of adenylate cyclase-inhibiting adrenergic receptor signaling pathway	ISS
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:1900924	Process	Negative regulation of glycine import across plasma membrane	IEA

MIM	HGNC	e!Ensembl
600861	9998	ENSG00000116741

P41220

Protein name

Regulator of G-protein signaling 2 (RGS2) (Cell growth-inhibiting gene 31 protein) (G0/G1 switch regulatory protein 8)

Protein function

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:11063746, PubMed:19478087). It i

PDB

2AF0 , 2V4Z , 4EKC , 4EKD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00615	RGS	83 → 198	Regulator of G protein signaling domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in acute myelogenous leukemia (AML) and in acute lymphoblastic leukemia (ALL). {ECO:0000269|PubMed:7643615}.

Sequence

MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT

Sequence length

211

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway Olfactory transduction Oxytocin signaling pathway		G alpha (q) signalling events

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
RGS2-related disorder	Benign	rs143288784	RCV003936886
Sarcoma	Benign	rs143288784	RCV005933164
Uterine corpus endometrial carcinoma	Benign	rs143288784	RCV005933165

Show/Hide Text Mining Associations (43)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Inhibit	27701409
Anxiety	Associate	18833580, 19162436, 20847599
Atherosclerosis	Associate	39198660
Attention Deficit Disorder with Hyperactivity	Associate	33115496
Breast Neoplasms	Inhibit	34849149, 36299824
Breast Neoplasms	Associate	37014700
Carcinoma Hepatocellular	Associate	40416605
Cardiovascular Diseases	Associate	27558088, 39198660
Cell Transformation Viral	Associate	15536149
Cerebral Infarction	Associate	31168961, 40442227
Cognition Disorders	Inhibit	27701409
Colorectal Neoplasms	Associate	35924235
Coronary Disease	Associate	32743916
Diabetes Mellitus Type 1	Associate	24562335
Drug Related Side Effects and Adverse Reactions	Associate	21779398
Essential Hypertension	Associate	20662725, 25849301
general anxiety disorder	Associate	18833580, 20847599
Huntington Disease	Associate	21779398
Hypertension	Associate	19478087, 20662725, 24593135, 27558088
Inflammation	Inhibit	25625944
Labor Pain	Associate	34493304
Laryngeal Neoplasms	Associate	36033826
Leukemia Myeloid Acute	Associate	15536149
Mental Disorders	Associate	18833580, 19162436, 20847599
Myocardial Infarction	Associate	39198660
Neoplasm Invasiveness	Associate	34041882
Neoplasm Metastasis	Associate	12472567
Neoplasms	Associate	34849149, 40295944
Neoplasms Second Primary	Associate	20627871
Panic Disorder	Associate	18833580, 20847599
Personality Disorders	Associate	20847599
Phobia Social	Associate	24154666
Pre Eclampsia	Associate	24593135, 27558088, 34493304
Prostatic Neoplasms Castration Resistant	Associate	28901445
Respiratory Distress Syndrome	Associate	34393665
Sepsis	Associate	34393665
Squamous Cell Carcinoma of Head and Neck	Associate	20627871
Squamous Cell Carcinoma of Head and Neck	Inhibit	34041882
Stomach Neoplasms	Associate	38274323
Stress Disorders Post Traumatic	Associate	19162436
Syncope Vasovagal	Associate	21737952
Urinary Bladder Neoplasms	Associate	25323766
Uveal melanoma	Inhibit	35452684

RGS2 (regulator of G protein signaling 2)