RGS1 (regulator of G protein signaling 1)

Gene

• Entrez ID: 5996
• Gene name: Regulator of G protein signaling 1
• Gene symbol: RGS1
• Synonyms (NCBI Gene): 1R20, BL34, HEL-S-87, IER1, IR20
• Chromosome: 1
• Chromosome location: 1q31.2
• Summary: This gene encodes a member of the regulator of G-protein signalling family. This protein is located on the cytosolic side of the plasma membrane and contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signalling ac

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT373740	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT373740	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT755339	hsa-miR-376b-3p	Luciferase reporter assay	34988161
MIRT1304127	hsa-miR-21	CLIP-seq
MIRT1304128	hsa-miR-3942-5p	CLIP-seq
MIRT1304129	hsa-miR-4703-5p	CLIP-seq
MIRT1304130	hsa-miR-4720-3p	CLIP-seq
MIRT1304131	hsa-miR-590-5p	CLIP-seq
MIRT2314896	hsa-miR-4659a-3p	CLIP-seq
MIRT2314897	hsa-miR-4659b-3p	CLIP-seq
MIRT2314898	hsa-miR-4778-3p	CLIP-seq
MIRT2314896	hsa-miR-4659a-3p	CLIP-seq
MIRT2314897	hsa-miR-4659b-3p	CLIP-seq
MIRT2314898	hsa-miR-4778-3p	CLIP-seq
MIRT2458132	hsa-miR-451b	CLIP-seq
MIRT2458133	hsa-miR-548n	CLIP-seq
MIRT2458134	hsa-miR-548t	CLIP-seq
MIRT2458135	hsa-miR-562	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IPI	18434541
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IDA	10480894, 18434541
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	10747990
GO:0005516	Function	Calmodulin binding	TAS	10747990
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	10480894
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10480894
GO:0006955	Process	Immune response	TAS	8241276
GO:0007165	Process	Signal transduction	IDA	10480894
GO:0007165	Process	Signal transduction	NAS	8241276
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	10480894
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	10480894
GO:0009617	Process	Response to bacterium	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	10480894
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IDA	10480894, 18434541
GO:0061737	Process	Leukotriene signaling pathway	IDA	10480894

Other IDs

• MIM: 600323
• HGNC: 9991
• e!Ensembl: ENSG00000090104

Protein

• UniProt ID: Q08116
• Protein name: Regulator of G-protein signaling 1 (RGS1) (B-cell activation protein BL34) (Early response protein 1R20)
• Protein function: Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the N-formylpeptide chemoattractant receptors and leukotriene receptors (PubMed:10480894). Inhibits B cell chemotaxis toward CXCL12 (By similarity). Inhib
• PDB: 2BV1, 2GTP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00615	RGS	85 → 199	Regulator of G protein signaling domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in peripheral blood monocytes (PubMed:10480894). Expression is relatively low in B-cells and chronic lymphocytic leukemia B-cells; however, in other types of malignant B-cell such as non-Hodgkin lymphoma and hairy cell leukemi
• Sequence:

  MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPH
  LESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACED
  YKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYT
  LMEKDSYPRFLKSDIYLNLLNDLQANSLK

• Sequence length: 209

Pathways

Reactome:

G alpha (q) signalling events
G alpha (i) signalling events