RGS1 (regulator of G protein signaling 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5996
Gene name Gene Name - the full gene name approved by the HGNC.
Regulator of G protein signaling 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RGS1
Synonyms (NCBI Gene) Gene synonyms aliases
1R20, BL34, HEL-S-87, IER1, IR20
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q31.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the regulator of G-protein signalling family. This protein is located on the cytosolic side of the plasma membrane and contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signalling ac
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(18)
miRTarBase ID miRNA Experiments Reference
MIRT373740 hsa-miR-374a-5p HITS-CLIP 22473208
MIRT373740 hsa-miR-374a-5p HITS-CLIP 22473208
MIRT755339 hsa-miR-376b-3p Luciferase reporter assay 34988161
MIRT1304127 hsa-miR-21 CLIP-seq
MIRT1304128 hsa-miR-3942-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(24)
GO ID Ontology Definition Evidence Reference
GO:0001965 Function G-protein alpha-subunit binding IPI 18434541
GO:0003924 Function GTPase activity IEA
GO:0003924 Function GTPase activity TAS
GO:0005096 Function GTPase activator activity IDA 10480894, 18434541
GO:0005096 Function GTPase activator activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
600323 9991 ENSG00000090104
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q08116
Protein name Regulator of G-protein signaling 1 (RGS1) (B-cell activation protein BL34) (Early response protein 1R20)
Protein function Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the N-formylpeptide chemoattractant receptors and leukotriene receptors (PubMed:10480894). Inhibits B cell chemotaxis toward CXCL12 (By similarity). Inhib
PDB 2BV1 , 2GTP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00615 RGS 85 → 199 Regulator of G protein signaling domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in peripheral blood monocytes (PubMed:10480894). Expression is relatively low in B-cells and chronic lymphocytic leukemia B-cells; however, in other types of malignant B-cell such as non-Hodgkin lymphoma and hairy cell leukemi
Sequence 
MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPH
LESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACED
YKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYT
LMEKDSYPRFLKSDIYLNLLNDLQANSLK
Sequence length 209
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    G alpha (q) signalling events
G alpha (i) signalling events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (4)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Celiac disease Celiac disease N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Ovarian cancer Epithelial ovarian cancer N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Show/Hide Text Mining Associations (43)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 37840493
Arthritis Rheumatoid Associate 36273177
Atherosclerosis Associate 22363809
Autoimmune Diseases Associate 26902301, 29182645, 36267464
Breast Neoplasms Associate 35819135
Carcinoma Hepatocellular Associate 36938729
Carcinoma Non Small Cell Lung Associate 21698121, 38081176
Carcinoma Renal Cell Associate 18301890, 23382860, 37735297
Celiac Disease Associate 19073967, 22087237
Colorectal Neoplasms Associate 26222051