Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5993
Gene name Gene Name - the full gene name approved by the HGNC.
Regulatory factor X5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RFX5
Synonyms (NCBI Gene) Gene synonyms aliases
MHC2D3, MHC2D5
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BL
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137853099 C>T Pathogenic, uncertain-significance 5 prime UTR variant, missense variant, coding sequence variant
rs748270285 C>T Pathogenic Splice acceptor variant
rs1557831362 G>A Pathogenic Coding sequence variant, synonymous variant
rs1571256140 ->G Likely-pathogenic Coding sequence variant, frameshift variant
rs1571260017 T>- Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT026061 hsa-miR-196a-5p Sequencing 20371350
MIRT032137 hsa-let-7d-5p Sequencing 20371350
MIRT042366 hsa-miR-484 CLASH 23622248
MIRT439779 hsa-miR-218-5p HITS-CLIP 23212916
MIRT439779 hsa-miR-218-5p HITS-CLIP 23212916
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 9806546
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601863 9986 ENSG00000143390
Protein
UniProt ID P48382
Protein name DNA-binding protein RFX5 (Regulatory factor X 5)
Protein function Activates transcription from class II MHC promoters. Recognizes X-boxes. Mediates cooperative binding between RFX and NF-Y. RFX binds the X1 box of MHC-II promoters.
PDB 2KW3 , 3V30
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18326 RFX5_N 28 86 RFX5 N-terminal domain Domain
PF02257 RFX_DNA_binding 89 168 RFX DNA-binding domain Domain
PF14621 RFX5_DNA_bdg 396 614 RFX5 DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDND
KLYLYLQLPSGPTTGDKSSEPSTLSN
EEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKY
CESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKT
LVSMPPLPGLDL
KGSESPEMGPEVTPAPRDELVEAACALTCDWAERILKRSFSSIVEVARFLLQQHLISARS
AHAHVLKAMGLAEEDEHAPRERSSKPKNGLENPEGGAHKKPERLAQPPKDLEARTGAGPL
ARGERKKSVVESSAPGANNLQVNALVARLPLLLPRAPRSLIPPIPVSPPILAPRLSSGAL
KVATLPLSSRAGAPPAAVPIINMILPTVPALPGPGPGPGRAPPGGLTQPRGTENREVGIG
GDQGPHDKGVKRTAEVPVSEASGQAPPAKAAKQDIEDTASDAKRKRGRPRKKSGGSGERN
STPLKSAAAMESAQSSRLPWETWGSGGEGNSAGGAERPGPMGEAEKGAVLAQGQGDGTVS
KGGRGPGSQHTKEAEDKIPLVPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVL
QSSLSQEHKDPKAT
PP
Sequence length 616
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Antigen processing and presentation
Tuberculosis
Primary immunodeficiency
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anodontia Associate 20013806
Bare lymphocyte syndrome 2 Associate 25445815, 9177217
Carcinogenesis Associate 31188160
Carcinoma Hepatocellular Associate 31188160, 32883983, 35291486
Carcinoma Non Small Cell Lung Associate 31096145
Colorectal Neoplasms Associate 20013806
Genetic Diseases Inborn Associate 12498778
Malocclusion Angle Class II Associate 12498778, 16848795, 7744245
Malocclusion Angle Class II Inhibit 29527204
Neoplasms Associate 20013806, 36045400