RFC4 (replication factor C subunit 4)

Gene

• Entrez ID: 5984
• Gene name: Replication factor C subunit 4
• Gene symbol: RFC4
• Synonyms (NCBI Gene): A1, MRMNS, RFC37
• Chromosome: 3
• Chromosome location: 3q27.3
• Summary: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consistin

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016352	hsa-miR-193b-3p	Microarray	20304954
MIRT024441	hsa-miR-215-5p	Microarray	19074876
MIRT026479	hsa-miR-192-5p	Microarray	19074876
MIRT1301602	hsa-miR-4528	CLIP-seq
MIRT1301603	hsa-miR-4699-3p	CLIP-seq
MIRT1301604	hsa-miR-520d-5p	CLIP-seq
MIRT1301605	hsa-miR-524-5p	CLIP-seq
MIRT1301606	hsa-miR-556-3p	CLIP-seq
MIRT1301606	hsa-miR-556-3p	CLIP-seq
MIRT1301602	hsa-miR-4528	CLIP-seq
MIRT1301603	hsa-miR-4699-3p	CLIP-seq
MIRT1301604	hsa-miR-520d-5p	CLIP-seq
MIRT1301605	hsa-miR-524-5p	CLIP-seq
MIRT1301606	hsa-miR-556-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003689	Function	DNA clamp loader activity	IBA
GO:0003689	Function	DNA clamp loader activity	IDA	12930902
GO:0005515	Function	Protein binding	IPI	9488738, 15655353, 16189514, 21516116, 23277426, 25416956, 28514442, 29892012, 30021884, 31515488, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005663	Component	DNA replication factor C complex	IBA
GO:0005663	Component	DNA replication factor C complex	IDA	9488738
GO:0005663	Component	DNA replication factor C complex	IPI	9488738
GO:0005694	Component	Chromosome	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006261	Process	DNA-templated DNA replication	IBA
GO:0006261	Process	DNA-templated DNA replication	IDA	9488738
GO:0006271	Process	DNA strand elongation involved in DNA replication	TAS	7774928
GO:0006281	Process	DNA repair	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0017116	Function	Single-stranded DNA helicase activity	IDA	12930902
GO:0019899	Function	Enzyme binding	IEA
GO:0031390	Component	Ctf18 RFC-like complex	IDA	12930902
GO:0031391	Component	Elg1 RFC-like complex	IDA	23277426
GO:1900264	Process	Positive regulation of DNA-directed DNA polymerase activity	IDA	12930902

Other IDs

• MIM: 102577
• HGNC: 9972
• e!Ensembl: ENSG00000163918

Protein

• UniProt ID: P35249
• Protein name: Replication factor C subunit 4 (Activator 1 37 kDa subunit) (A1 37 kDa subunit) (Activator 1 subunit 4) (Replication factor C 37 kDa subunit) (RF-C 37 kDa subunit) (RFC37)
• Protein function: Subunit of the replication factor C (RFC) complex which acts during elongation of primed DNA templates by DNA polymerases delta and epsilon, and is necessary for ATP-dependent loading of proliferating cell nuclear antigen (PCNA) onto primed DNA.
• PDB: 6VVO, 7Z6H, 8UI7, 8UI8, 8UI9, 8UII, 8UMT, 8UMU, 8UMV, 8UMW, 8UMY, 8UN0, 8UNJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00004	AAA	74 → 202	ATPase family associated with various cellular activities (AAA)	Domain
  PF08542	Rep_fac_C	269 → 354	Replication factor C C-terminal domain	Domain

• Sequence:

  MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVA
  VLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVR
  EKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLIC
  NYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRK
  AITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEG
  HAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLS
  QNC

• Sequence length: 363

Pathways

KEGG:

DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair

Reactome:

Translesion synthesis by REV1
Recognition of DNA damage by PCNA-containing replication complex
Translesion Synthesis by POLH
Polymerase switching on the C-strand of the telomere
Activation of ATR in response to replication stress
PCNA-Dependent Long Patch Base Excision Repair
Translesion synthesis by POLK
Translesion synthesis by POLI
Termination of translesion DNA synthesis
HDR through Single Strand Annealing (SSA)
HDR through Homologous Recombination (HRR)
Processing of DNA double-strand break ends
Presynaptic phase of homologous DNA pairing and strand exchange
Gap-filling DNA repair synthesis and ligation in GG-NER
Dual Incision in GG-NER
Dual incision in TC-NER
Gap-filling DNA repair synthesis and ligation in TC-NER
Regulation of TP53 Activity through Phosphorylation
Polymerase switching
G2/M DNA damage checkpoint