Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5984
Gene name Gene Name - the full gene name approved by the HGNC.	Replication factor C subunit 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RFC4
Synonyms (NCBI Gene) Gene synonyms aliases	A1, MRMNS, RFC37
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q27.3
Summary Summary of gene provided in NCBI Entrez Gene.	The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consistin

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016352	hsa-miR-193b-3p	Microarray	20304954
MIRT024441	hsa-miR-215-5p	Microarray	19074876
MIRT026479	hsa-miR-192-5p	Microarray	19074876
MIRT1301602	hsa-miR-4528	CLIP-seq
MIRT1301603	hsa-miR-4699-3p	CLIP-seq
MIRT1301604	hsa-miR-520d-5p	CLIP-seq
MIRT1301605	hsa-miR-524-5p	CLIP-seq
MIRT1301606	hsa-miR-556-3p	CLIP-seq
MIRT1301606	hsa-miR-556-3p	CLIP-seq
MIRT1301602	hsa-miR-4528	CLIP-seq
MIRT1301603	hsa-miR-4699-3p	CLIP-seq
MIRT1301604	hsa-miR-520d-5p	CLIP-seq
MIRT1301605	hsa-miR-524-5p	CLIP-seq
MIRT1301606	hsa-miR-556-3p	CLIP-seq

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003689	Function	DNA clamp loader activity	IBA
GO:0003689	Function	DNA clamp loader activity	IDA	12930902
GO:0005515	Function	Protein binding	IPI	9488738, 15655353, 16189514, 21516116, 23277426, 25416956, 28514442, 29892012, 30021884, 31515488, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005663	Component	DNA replication factor C complex	IBA
GO:0005663	Component	DNA replication factor C complex	IDA	9488738
GO:0005663	Component	DNA replication factor C complex	IPI	9488738
GO:0005694	Component	Chromosome	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006261	Process	DNA-templated DNA replication	IBA
GO:0006261	Process	DNA-templated DNA replication	IDA	9488738
GO:0006271	Process	DNA strand elongation involved in DNA replication	TAS	7774928
GO:0006281	Process	DNA repair	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0017116	Function	Single-stranded DNA helicase activity	IDA	12930902
GO:0019899	Function	Enzyme binding	IEA
GO:0031390	Component	Ctf18 RFC-like complex	IDA	12930902
GO:0031391	Component	Elg1 RFC-like complex	IDA	23277426
GO:1900264	Process	Positive regulation of DNA-directed DNA polymerase activity	IDA	12930902

MIM	HGNC	e!Ensembl
102577	9972	ENSG00000163918

Protein

UniProt ID

P35249

Protein name

Replication factor C subunit 4 (Activator 1 37 kDa subunit) (A1 37 kDa subunit) (Activator 1 subunit 4) (Replication factor C 37 kDa subunit) (RF-C 37 kDa subunit) (RFC37)

Protein function

Subunit of the replication factor C (RFC) complex which acts during elongation of primed DNA templates by DNA polymerases delta and epsilon, and is necessary for ATP-dependent loading of proliferating cell nuclear antigen (PCNA) onto primed DNA.

PDB

6VVO , 7Z6H , 8UI7 , 8UI8 , 8UI9 , 8UII , 8UMT , 8UMU , 8UMV , 8UMW , 8UMY , 8UN0 , 8UNJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00004	AAA	74 → 202	ATPase family associated with various cellular activities (AAA)	Domain
PF08542	Rep_fac_C	269 → 354	Replication factor C C-terminal domain	Domain

Sequence

MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVA
VLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVR
EKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLIC
NYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRK
AITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEG
HAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLS
QNC

Sequence length

363

Interactions

View interactions

	KEGG		Reactome
	DNA replication Base excision repair Nucleotide excision repair Mismatch repair		Translesion synthesis by REV1 Recognition of DNA damage by PCNA-containing replication complex Translesion Synthesis by POLH Polymerase switching on the C-strand of the telomere Activation of ATR in response to replication stress PCNA-Dependent Long Patch Base Excision Repair Translesion synthesis by POLK Translesion synthesis by POLI Termination of translesion DNA synthesis HDR through Single Strand Annealing (SSA) HDR through Homologous Recombination (HRR) Processing of DNA double-strand break ends Presynaptic phase of homologous DNA pairing and strand exchange Gap-filling DNA repair synthesis and ligation in GG-NER Dual Incision in GG-NER Dual incision in TC-NER Gap-filling DNA repair synthesis and ligation in TC-NER Regulation of TP53 Activity through Phosphorylation Polymerase switching G2/M DNA damage checkpoint

RFC4 (replication factor C subunit 4)