Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5982
Gene name Gene Name - the full gene name approved by the HGNC.
Replication factor C subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RFC2
Synonyms (NCBI Gene) Gene synonyms aliases
RFC40
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the activator 1 small subunits family. The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins, proliferating cell nuclear antigen (PCNA) and replication factor
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023820 hsa-miR-1-3p Proteomics 18668040
MIRT048154 hsa-miR-196a-5p CLASH 23622248
MIRT045679 hsa-miR-149-5p CLASH 23622248
MIRT629588 hsa-miR-4999-3p HITS-CLIP 19536157
MIRT629587 hsa-miR-767-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003689 Function DNA clamp loader activity IBA 21873635
GO:0003689 Function DNA clamp loader activity IDA 12930902
GO:0005515 Function Protein binding IPI 9488738, 15655353, 18499658
GO:0005524 Function ATP binding IEA
GO:0005634 Component Nucleus IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600404 9970 ENSG00000049541
Protein
UniProt ID P35250
Protein name Replication factor C subunit 2 (Activator 1 40 kDa subunit) (A1 40 kDa subunit) (Activator 1 subunit 2) (Replication factor C 40 kDa subunit) (RF-C 40 kDa subunit) (RFC40)
Protein function Subunit of the replication factor C (RFC) complex which acts during elongation of primed DNA templates by DNA polymerases delta and epsilon, and is necessary for ATP-dependent loading of proliferating cell nuclear antigen (PCNA) onto primed DNA
PDB 6VVO , 7Z6H , 8UI7 , 8UI8 , 8UI9 , 8UII , 8UMT , 8UMU , 8UMV , 8UMW , 8UMY , 8UN0 , 8UNJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00004 AAA 72 193 ATPase family associated with various cellular activities (AAA) Domain
PF08542 Rep_fac_C 258 343 Replication factor C C-terminal domain Domain
Sequence
MEVEAVCGGAGEVEAQDSDPAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRL
EVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDRGIDVVRNKI
KMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEP
IQSRCAVLRYTKL
TDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTF
SGFGFINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPEDIIGNIF
RVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLAR
LCQKTMAPVAS
Sequence length 354
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
  Translesion synthesis by REV1
Recognition of DNA damage by PCNA-containing replication complex
Translesion Synthesis by POLH
Polymerase switching on the C-strand of the telomere
Activation of ATR in response to replication stress
PCNA-Dependent Long Patch Base Excision Repair
Translesion synthesis by POLK
Translesion synthesis by POLI
Termination of translesion DNA synthesis
HDR through Single Strand Annealing (SSA)
HDR through Homologous Recombination (HRR)
Processing of DNA double-strand break ends
Presynaptic phase of homologous DNA pairing and strand exchange
Gap-filling DNA repair synthesis and ligation in GG-NER
Dual Incision in GG-NER
Dual incision in TC-NER
Gap-filling DNA repair synthesis and ligation in TC-NER
Regulation of TP53 Activity through Phosphorylation
Polymerase switching
G2/M DNA damage checkpoint
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Atrial septal defect Atrial Septal Defects rs137852951, rs137852953, rs137852955, rs267607106, rs104893900, rs104893901, rs104893903, rs606231358, rs606231359, rs137852683, rs606231360, rs104893907, rs104894073, rs1585703301, rs104894074
View all (25 more)
Attention deficit hyperactivity disorder Attention deficit hyperactivity disorder rs786205019
Autism Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
Bicuspid aortic valve Bicuspid aortic valve rs1569484234, rs1569484208
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure ClinVar
Mental depression Depressive disorder ClinVar
Myocardial infarction Myocardial Infarction ClinVar
Otitis media Chronic otitis media ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Stimulate 34022962
Choriocarcinoma Stimulate 15846072
Colorectal Neoplasms Associate 30658502, 37821801
Diabetes Mellitus Type 2 Associate 31797865
DNA Virus Infections Associate 23112151
Esophageal Squamous Cell Carcinoma Associate 31845510
Fanconi Anemia Associate 34404366
Gestational Trophoblastic Disease Stimulate 15846072
Glioblastoma Associate 15494095
Glioma Associate 35210438