Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5981
Gene name	Replication factor C subunit 1
Gene symbol	RFC1
Synonyms (NCBI Gene)	A1CANVASMHCBFBPO-GARECC1RFCRFC140
Chromosome	4
Chromosome location	4p14
Summary	This gene encodes the large subunit of replication factor C, a five subunit DNA polymerase accessory protein, which is a DNA-dependent ATPase required for eukaryotic DNA replication and repair. The large subunit acts as an activator of DNA polymerases, bi

197

Show/Hide all (197)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046779	hsa-miR-222-3p	CLASH	23622248
MIRT042834	hsa-miR-324-3p	CLASH	23622248
MIRT439781	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439781	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1301486	hsa-let-7a	CLIP-seq
MIRT1301487	hsa-let-7b	CLIP-seq
MIRT1301488	hsa-let-7c	CLIP-seq
MIRT1301489	hsa-let-7d	CLIP-seq
MIRT1301490	hsa-let-7e	CLIP-seq
MIRT1301491	hsa-let-7f	CLIP-seq
MIRT1301492	hsa-let-7g	CLIP-seq
MIRT1301493	hsa-let-7i	CLIP-seq
MIRT1301494	hsa-miR-3144-3p	CLIP-seq
MIRT1301495	hsa-miR-3145-5p	CLIP-seq
MIRT1301496	hsa-miR-3190	CLIP-seq
MIRT1301497	hsa-miR-345	CLIP-seq
MIRT1301498	hsa-miR-3934	CLIP-seq
MIRT1301499	hsa-miR-4257	CLIP-seq
MIRT1301500	hsa-miR-4436a	CLIP-seq
MIRT1301501	hsa-miR-4458	CLIP-seq
MIRT1301502	hsa-miR-4500	CLIP-seq
MIRT1301503	hsa-miR-4700-3p	CLIP-seq
MIRT1301504	hsa-miR-4703-3p	CLIP-seq
MIRT1301505	hsa-miR-4726-3p	CLIP-seq
MIRT1301506	hsa-miR-4752	CLIP-seq
MIRT1301507	hsa-miR-4777-3p	CLIP-seq
MIRT1301508	hsa-miR-4786-3p	CLIP-seq
MIRT1301509	hsa-miR-513a-5p	CLIP-seq
MIRT1301510	hsa-miR-671-5p	CLIP-seq
MIRT1301511	hsa-miR-875-5p	CLIP-seq
MIRT1301512	hsa-miR-98	CLIP-seq
MIRT1301513	hsa-miR-1278	CLIP-seq
MIRT1301514	hsa-miR-1283	CLIP-seq
MIRT1301515	hsa-miR-139-5p	CLIP-seq
MIRT1301516	hsa-miR-1915	CLIP-seq
MIRT1301517	hsa-miR-2053	CLIP-seq
MIRT1301518	hsa-miR-28-3p	CLIP-seq
MIRT1301519	hsa-miR-3155	CLIP-seq
MIRT1301520	hsa-miR-3155b	CLIP-seq
MIRT1301498	hsa-miR-3934	CLIP-seq
MIRT1301521	hsa-miR-4528	CLIP-seq
MIRT1301504	hsa-miR-4703-3p	CLIP-seq
MIRT1301505	hsa-miR-4726-3p	CLIP-seq
MIRT1301522	hsa-miR-484	CLIP-seq
MIRT1301515	hsa-miR-139-5p	CLIP-seq
MIRT2089500	hsa-miR-1910	CLIP-seq
MIRT1301495	hsa-miR-3145-5p	CLIP-seq
MIRT2089501	hsa-miR-3148	CLIP-seq
MIRT2089502	hsa-miR-3153	CLIP-seq
MIRT2089503	hsa-miR-3192	CLIP-seq
MIRT2089504	hsa-miR-3194-3p	CLIP-seq
MIRT2089505	hsa-miR-326	CLIP-seq
MIRT2089506	hsa-miR-330-5p	CLIP-seq
MIRT1301497	hsa-miR-345	CLIP-seq
MIRT2089507	hsa-miR-3663-5p	CLIP-seq
MIRT2089508	hsa-miR-3672	CLIP-seq
MIRT1301498	hsa-miR-3934	CLIP-seq
MIRT2089509	hsa-miR-3940-5p	CLIP-seq
MIRT2089510	hsa-miR-4274	CLIP-seq
MIRT2089511	hsa-miR-4314	CLIP-seq
MIRT2089512	hsa-miR-4507	CLIP-seq
MIRT2089513	hsa-miR-4527	CLIP-seq
MIRT2089514	hsa-miR-4539	CLIP-seq
MIRT2089515	hsa-miR-4646-5p	CLIP-seq
MIRT2089516	hsa-miR-4668-5p	CLIP-seq
MIRT1301504	hsa-miR-4703-3p	CLIP-seq
MIRT1301505	hsa-miR-4726-3p	CLIP-seq
MIRT2089517	hsa-miR-4789-3p	CLIP-seq
MIRT2089518	hsa-miR-579	CLIP-seq
MIRT2089519	hsa-miR-582-5p	CLIP-seq
MIRT2610807	hsa-miR-1184	CLIP-seq
MIRT2610808	hsa-miR-1205	CLIP-seq
MIRT2610809	hsa-miR-134	CLIP-seq
MIRT1301515	hsa-miR-139-5p	CLIP-seq
MIRT2610810	hsa-miR-186	CLIP-seq
MIRT2089500	hsa-miR-1910	CLIP-seq
MIRT2610811	hsa-miR-1912	CLIP-seq
MIRT2610812	hsa-miR-197	CLIP-seq
MIRT2610813	hsa-miR-2052	CLIP-seq
MIRT2610814	hsa-miR-217	CLIP-seq
MIRT2610815	hsa-miR-3118	CLIP-seq
MIRT2610816	hsa-miR-3130-5p	CLIP-seq
MIRT1301495	hsa-miR-3145-5p	CLIP-seq
MIRT2610817	hsa-miR-3149	CLIP-seq
MIRT2610818	hsa-miR-3158-5p	CLIP-seq
MIRT2610819	hsa-miR-3168	CLIP-seq
MIRT2610820	hsa-miR-3177-5p	CLIP-seq
MIRT2610821	hsa-miR-3182	CLIP-seq
MIRT2610822	hsa-miR-3189-5p	CLIP-seq
MIRT2089507	hsa-miR-3663-5p	CLIP-seq
MIRT2089508	hsa-miR-3672	CLIP-seq
MIRT2610823	hsa-miR-3685	CLIP-seq
MIRT2610824	hsa-miR-377	CLIP-seq
MIRT2610825	hsa-miR-3914	CLIP-seq
MIRT1301498	hsa-miR-3934	CLIP-seq
MIRT2089509	hsa-miR-3940-5p	CLIP-seq
MIRT2610826	hsa-miR-3943	CLIP-seq
MIRT2610827	hsa-miR-4251	CLIP-seq
MIRT2089510	hsa-miR-4274	CLIP-seq
MIRT2610828	hsa-miR-4277	CLIP-seq
MIRT2610829	hsa-miR-4282	CLIP-seq
MIRT2610830	hsa-miR-4307	CLIP-seq
MIRT2610831	hsa-miR-4323	CLIP-seq
MIRT2610832	hsa-miR-4329	CLIP-seq
MIRT2610833	hsa-miR-4482	CLIP-seq
MIRT2089512	hsa-miR-4507	CLIP-seq
MIRT2610834	hsa-miR-450b-5p	CLIP-seq
MIRT2610835	hsa-miR-452	CLIP-seq
MIRT2089513	hsa-miR-4527	CLIP-seq
MIRT2089514	hsa-miR-4539	CLIP-seq
MIRT2610836	hsa-miR-4676-3p	CLIP-seq
MIRT2610837	hsa-miR-4699-3p	CLIP-seq
MIRT1301504	hsa-miR-4703-3p	CLIP-seq
MIRT2610838	hsa-miR-4714-3p	CLIP-seq
MIRT1301505	hsa-miR-4726-3p	CLIP-seq
MIRT2610839	hsa-miR-4729	CLIP-seq
MIRT2610840	hsa-miR-4751	CLIP-seq
MIRT2610841	hsa-miR-508-5p	CLIP-seq
MIRT2610842	hsa-miR-5096	CLIP-seq
MIRT2610843	hsa-miR-513a-3p	CLIP-seq
MIRT2610844	hsa-miR-518a-5p	CLIP-seq
MIRT2610845	hsa-miR-520d-5p	CLIP-seq
MIRT2610846	hsa-miR-524-5p	CLIP-seq
MIRT2610847	hsa-miR-527	CLIP-seq
MIRT2610848	hsa-miR-544	CLIP-seq
MIRT2610849	hsa-miR-568	CLIP-seq
MIRT2089518	hsa-miR-579	CLIP-seq
MIRT2610850	hsa-miR-580	CLIP-seq
MIRT2610851	hsa-miR-654-3p	CLIP-seq
MIRT2610852	hsa-miR-711	CLIP-seq
MIRT2610853	hsa-miR-765	CLIP-seq
MIRT2610854	hsa-miR-767-3p	CLIP-seq
MIRT2610855	hsa-miR-943	CLIP-seq
MIRT2610807	hsa-miR-1184	CLIP-seq
MIRT2610808	hsa-miR-1205	CLIP-seq
MIRT2610809	hsa-miR-134	CLIP-seq
MIRT1301515	hsa-miR-139-5p	CLIP-seq
MIRT2610810	hsa-miR-186	CLIP-seq
MIRT2089500	hsa-miR-1910	CLIP-seq
MIRT2610811	hsa-miR-1912	CLIP-seq
MIRT2610812	hsa-miR-197	CLIP-seq
MIRT2610813	hsa-miR-2052	CLIP-seq
MIRT2610815	hsa-miR-3118	CLIP-seq
MIRT2610816	hsa-miR-3130-5p	CLIP-seq
MIRT1301495	hsa-miR-3145-5p	CLIP-seq
MIRT2610817	hsa-miR-3149	CLIP-seq
MIRT2610818	hsa-miR-3158-5p	CLIP-seq
MIRT2610819	hsa-miR-3168	CLIP-seq
MIRT2610820	hsa-miR-3177-5p	CLIP-seq
MIRT2610821	hsa-miR-3182	CLIP-seq
MIRT2610822	hsa-miR-3189-5p	CLIP-seq
MIRT2089507	hsa-miR-3663-5p	CLIP-seq
MIRT2089508	hsa-miR-3672	CLIP-seq
MIRT2610823	hsa-miR-3685	CLIP-seq
MIRT2610824	hsa-miR-377	CLIP-seq
MIRT2610825	hsa-miR-3914	CLIP-seq
MIRT1301498	hsa-miR-3934	CLIP-seq
MIRT2089509	hsa-miR-3940-5p	CLIP-seq
MIRT2610826	hsa-miR-3943	CLIP-seq
MIRT2610827	hsa-miR-4251	CLIP-seq
MIRT2089510	hsa-miR-4274	CLIP-seq
MIRT2610828	hsa-miR-4277	CLIP-seq
MIRT2610829	hsa-miR-4282	CLIP-seq
MIRT2610830	hsa-miR-4307	CLIP-seq
MIRT2610831	hsa-miR-4323	CLIP-seq
MIRT2610832	hsa-miR-4329	CLIP-seq
MIRT2610833	hsa-miR-4482	CLIP-seq
MIRT2089512	hsa-miR-4507	CLIP-seq
MIRT2610834	hsa-miR-450b-5p	CLIP-seq
MIRT2610835	hsa-miR-452	CLIP-seq
MIRT2089513	hsa-miR-4527	CLIP-seq
MIRT2089514	hsa-miR-4539	CLIP-seq
MIRT2610836	hsa-miR-4676-3p	CLIP-seq
MIRT2610837	hsa-miR-4699-3p	CLIP-seq
MIRT1301504	hsa-miR-4703-3p	CLIP-seq
MIRT2610838	hsa-miR-4714-3p	CLIP-seq
MIRT1301505	hsa-miR-4726-3p	CLIP-seq
MIRT2610839	hsa-miR-4729	CLIP-seq
MIRT2689674	hsa-miR-4735-5p	CLIP-seq
MIRT2610840	hsa-miR-4751	CLIP-seq
MIRT2689675	hsa-miR-488	CLIP-seq
MIRT2610841	hsa-miR-508-5p	CLIP-seq
MIRT2610842	hsa-miR-5096	CLIP-seq
MIRT2610843	hsa-miR-513a-3p	CLIP-seq
MIRT2610844	hsa-miR-518a-5p	CLIP-seq
MIRT2610845	hsa-miR-520d-5p	CLIP-seq
MIRT2610846	hsa-miR-524-5p	CLIP-seq
MIRT2610847	hsa-miR-527	CLIP-seq
MIRT2610848	hsa-miR-544	CLIP-seq
MIRT2610849	hsa-miR-568	CLIP-seq
MIRT2089518	hsa-miR-579	CLIP-seq
MIRT2610850	hsa-miR-580	CLIP-seq
MIRT2610851	hsa-miR-654-3p	CLIP-seq
MIRT2610852	hsa-miR-711	CLIP-seq
MIRT2610853	hsa-miR-765	CLIP-seq
MIRT2610854	hsa-miR-767-3p	CLIP-seq
MIRT2610855	hsa-miR-943	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003689	Function	DNA clamp loader activity	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	9488738, 15655353, 16438930
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	TAS	8248204
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005663	Component	DNA replication factor C complex	IDA	9488738
GO:0005663	Component	DNA replication factor C complex	IEA
GO:0005663	Component	DNA replication factor C complex	IPI	9488738
GO:0005694	Component	Chromosome	IEA
GO:0006260	Process	DNA replication	IEA
GO:0006261	Process	DNA-templated DNA replication	IDA	9488738
GO:0006261	Process	DNA-templated DNA replication	TAS	8248204
GO:0006281	Process	DNA repair	IEA
GO:0007004	Process	Telomere maintenance via telomerase	TAS	8954124
GO:0008047	Function	Enzyme activator activity	TAS	8954124
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0031391	Component	Elg1 RFC-like complex	IDA	23277426
GO:0032991	Component	Protein-containing complex	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0061860	Function	DNA clamp unloader activity	IBA
GO:0061860	Function	DNA clamp unloader activity	IMP	23277426
GO:0070062	Component	Extracellular exosome	HDA
GO:0140297	Function	DNA-binding transcription factor binding	IEA

MIM	HGNC	e!Ensembl
102579	9969	ENSG00000035928

P35251

Protein name

Replication factor C subunit 1 (Activator 1 140 kDa subunit) (A1 140 kDa subunit) (Activator 1 large subunit) (Activator 1 subunit 1) (DNA-binding protein PO-GA) (Replication factor C 140 kDa subunit) (RF-C 140 kDa subunit) (RFC140) (Replication factor C

Protein function

Subunit of the replication factor C (RFC) complex which acts during elongation of primed DNA templates by DNA polymerases delta and epsilon, and is necessary for ATP-dependent loading of proliferating cell nuclear antigen (PCNA) onto primed DNA

PDB

2EBU , 2K6G , 2K7F , 6VVO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00533	BRCT	402 → 479	BRCA1 C Terminus (BRCT) domain	Family
PF00004	AAA	647 → 776	ATPase family associated with various cellular activities (AAA)	Domain
PF08519	RFC1	915 → 1068	Replication factor RFC1 C terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Wide tissue distribution. Undetectable in placental tissue.

Sequence

MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPS
KKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISETDEEDDFMCKK
AASKSKENGRSTNSHLGTSNMKKNEENTKTKNKPLSPIKLTPTSVLDYFGTGSVQRSNKK
MVASKRKELSQNTDESGLNDEAIAKQLQLDEDAELERQLHEDEEFARTLAMLDEEPKTKK
ARKDTEAGETFSSVQANLSKAEKHKYPHKVKTAQVSDERKSYSPRKQSKYESSKESQQHS
KSSADKIGEVSSPKASSKLAIMKRKEESSYKEIEPVASKRKENAIKLKGETKTPKKTKSS
PAKKESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVLES
IERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIR
TMPGKKSKYEIAVETEMKKESKLERTPQKNVQGKRKISPSKKESESKKSRPTSKRDSLAK
TIKKETDVFWKSLDFKEQVAEETSGDSKARNLADDSSENKVENLLWVDKYKPTSLKTIIG
QQGDQSCANKLLRWLRNWQKSSSEDKKHAAKFGKFSGKDDGSSFKAALLSGPPGVGKTTT
ASLVCQELGYSYVELNASDTRSKSSLKAIVAESLNNTSIKGFYSNGAASSVSTKHALIMD
EVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQI
KGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRA
KKDIKMGPFDVARKVFAAGEETAHMSLVDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGD
MKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFP
SWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQD
VVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAI
KASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKTKSSKPSKPEKDKEPRK
GKGKSSKK

Sequence length

1148

Interactions

View interactions

	KEGG		Reactome
	DNA replication Base excision repair Nucleotide excision repair Mismatch repair		Translesion synthesis by REV1 Recognition of DNA damage by PCNA-containing replication complex Translesion Synthesis by POLH Polymerase switching on the C-strand of the telomere PCNA-Dependent Long Patch Base Excision Repair Translesion synthesis by POLK Translesion synthesis by POLI Termination of translesion DNA synthesis HDR through Homologous Recombination (HRR) Gap-filling DNA repair synthesis and ligation in GG-NER Dual Incision in GG-NER Dual incision in TC-NER Gap-filling DNA repair synthesis and ligation in TC-NER Polymerase switching

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cerebellar ataxia with neuropathy and bilateral vestibular areflexia syndrome	Likely pathogenic; Pathogenic	rs2600447, rs1035947105, rs2475602035, rs2475515249, rs2475507533	RCV002280370 RCV003324872 RCV003324873 RCV003324874 RCV003324875

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Benign	rs17288820	RCV005904730
Colon adenocarcinoma	Benign	rs17288820	RCV005904729
Gastric cancer	Benign	rs17288820	RCV005904731
Hereditary breast ovarian cancer syndrome	Uncertain significance	rs2109618140	RCV001374549
Lung cancer	Benign	rs17288820	RCV005904734
Ovarian serous cystadenocarcinoma	Benign	rs199870202, rs17288820	RCV005933483 RCV005904732
RFC1-related disorder	Likely benign; Benign; Uncertain significance	rs61759896, rs2066786, rs183190812, rs17335299, rs2066782, rs367640155, rs137867721, rs76241377, rs199870202, rs11932767, rs17288820, rs2066791, rs17335452	RCV003941110 RCV003984108 RCV003946413 RCV003906699 RCV003967378 RCV003952114 RCV003924768 RCV003969266 RCV003964265 RCV003962834 RCV003940597 RCV003920812 RCV003977969
Uterine carcinosarcoma	Benign	rs17288820	RCV005904733
Uterine corpus endometrial carcinoma	Benign	rs199870202, rs17288820	RCV005933484 RCV005904735

Show/Hide Text Mining Associations (82)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adrenoleukodystrophy	Associate	19353223
Alopecia	Associate	25599563
Amyotrophic lateral sclerosis 1	Associate	34537679
Arthritis Rheumatoid	Associate	25599563
Ataxia	Associate	32910249, 33495376, 33884451, 35001451, 35864213, 37578187, 38487929
Ataxia and Polyneuropathy Adult Onset	Associate	35864213
Atrophy	Associate	34927205
Autistic Disorder	Associate	20468076
Benign Paroxysmal Positional Vertigo	Associate	35502508, 38381176
Bilateral Vestibulopathy	Associate	30926972, 33884451, 33969391, 35502508, 36805468, 37460231, 38381176
Bronchiolitis Obliterans Syndrome	Associate	20574454
CANVAS syndrome	Associate	30926972, 31230722, 32851396, 32910249, 33103729, 33495376, 34537679, 34600502, 34927205, 35502508, 35864213, 36289003, 36805468, 37450567, 37853169 View all (4 more)
Carcinoma Hepatocellular	Associate	27782152, 27936032, 34022962
CD59 Deficiency	Associate	37853169
Cerebellar Ataxia	Associate	33884451, 33969391, 35502508, 36805468, 38487929
Cerebellar Diseases	Associate	34927205, 37460231, 38381176, 40461673
Charcot Marie Tooth Disease	Associate	34600502
Chorea	Associate	33495376
Cognition Disorders	Associate	34927205
Colorectal Neoplasms	Associate	25697897, 26193446
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	31297992
Congenital central hypoventilation syndrome	Associate	33684136
Congenital idiopathic intestinal pseudoobstruction	Associate	34927205
Conotruncal cardiac defects	Associate	24585533
Cough	Associate	33969391, 34927205, 38487929
Deglutition Disorders	Associate	38193360
Dementia Vascular	Associate	24554143
Demyelinating Diseases	Associate	37853169
Diabetes Mellitus Type 2	Associate	31797865
Disease	Associate	38193360
Down Syndrome	Associate	20868477
Drug Related Side Effects and Adverse Reactions	Associate	31617429
Dysarthria	Associate	37460231
Dystonia	Associate	33495376
Fasciculation	Associate	33103729
Glycoprotein Storage Disease	Associate	37853169
Graft vs Host Disease	Associate	20574454
Guillain Barre Syndrome	Associate	37853169
Head and Neck Neoplasms	Associate	23276522
Heart Defects Congenital	Associate	33684136
Hereditary Sensory and Autonomic Neuropathies	Associate	33884451, 33969391, 37853169
Hypokinesia	Stimulate	33495376
Immunoglobulin G4 Related Disease	Associate	37578187
Machado Joseph Disease	Associate	31230722
Melanoma	Associate	23659246
Multiple System Atrophy	Associate	33495376
Multiple system atrophy (MSA) with orthostatic hypotension	Associate	33495376
Muscle Spasticity	Associate	34927205
Muscular Atrophy Spinal	Associate	30926972, 34927205
Myotonic Dystrophy	Associate	40113266
Neoplasm Metastasis	Associate	34022962
Neoplasms	Associate	12509469, 34022962
Nerve Degeneration	Associate	34927205
Nervous System Diseases	Associate	33884451, 35864213, 38193360, 38487929
Neural Tube Defects	Associate	15060097
Neuralgia	Associate	38381176
Neuroblastoma	Associate	25536437
Neurologic Manifestations	Associate	39231235
Nystagmus Pathologic	Associate	33495376, 37460231, 38381176
Ovarian Neoplasms	Associate	26464638
Paraneoplastic Polyneuropathy	Associate	33969391
Parkinson Disease Secondary	Associate	34927205
Polycystic Ovary Syndrome	Associate	31482954
Polyneuropathies	Associate	33884451, 33969391, 37460231, 38381176
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	33969391
Postural Orthostatic Tachycardia Syndrome	Associate	33495376
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	31499477
Primary Dysautonomias	Associate	33495376, 34927205
Progeria	Associate	22168243
Prostatic Neoplasms	Associate	33414468
Reflex Abnormal	Associate	37460231
Sarcoma	Associate	35483337
Sjogren's Syndrome	Associate	33969391, 37853169
Spastic Ataxia	Associate	31230722
Spastic ataxia Charlevoix Saguenay type	Associate	31230722
Spinocerebellar Degenerations	Associate	30926972
Uterine Cervical Dysplasia	Associate	24089416
Uterine Cervical Neoplasms	Associate	19389243
Vestibular Diseases	Associate	34927205
Voice Disorders	Associate	33884451
West Nile Fever	Associate	21881118
Wilms Tumor	Associate	25536437

RFC1 (replication factor C subunit 1)