Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	598
Gene name Gene Name - the full gene name approved by the HGNC.	BCL2 like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BCL2L1
Synonyms (NCBI Gene) Gene synonyms aliases	BCL-XL/S, BCL2L, BCLX, Bcl-X, PPP1R52
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q11.21
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gen

Show/Hide all(572)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004285	hsa-miR-491-5p	Luciferase reporter assay, Western blot	20039318
MIRT004490	hsa-let-7g-5p	Luciferase reporter assay, qRT-PCR, Western blot	20347499
MIRT004491	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR, Western blot	20347499
MIRT004491	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR, Western blot	22917031
MIRT004491	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR, Western blot	22917031
MIRT023334	hsa-miR-122-5p	Western blot;qRT-PCR	18692484
MIRT028457	hsa-miR-30a-5p	Proteomics	18668040
MIRT052647	hsa-miR-133a-3p	Luciferase reporter assay, Western blot	23756231
MIRT046292	hsa-miR-23b-3p	CLASH	23622248
MIRT042070	hsa-miR-484	CLASH	23622248
MIRT004285	hsa-miR-491-5p	Flow cytometry, GFP reporter, QRTPCR, Western blot	23519249
MIRT528165	hsa-miR-449b-3p	PAR-CLIP	22012620
MIRT528164	hsa-miR-4691-3p	PAR-CLIP	22012620
MIRT528163	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT528162	hsa-miR-4722-3p	PAR-CLIP	22012620
MIRT528161	hsa-miR-6727-3p	PAR-CLIP	22012620
MIRT528160	hsa-miR-6747-3p	PAR-CLIP	22012620
MIRT528159	hsa-miR-1976	PAR-CLIP	22012620
MIRT528158	hsa-miR-1913	PAR-CLIP	22012620
MIRT528157	hsa-miR-324-3p	PAR-CLIP	22012620
MIRT528156	hsa-miR-4313	PAR-CLIP	22012620
MIRT528155	hsa-miR-587	PAR-CLIP	22012620
MIRT528154	hsa-miR-4749-3p	PAR-CLIP	22012620
MIRT455304	hsa-miR-6858-3p	PAR-CLIP	23592263
MIRT455303	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT455302	hsa-miR-575	PAR-CLIP	23592263
MIRT455300	hsa-miR-4779	PAR-CLIP	23592263
MIRT455301	hsa-miR-4257	PAR-CLIP	23592263
MIRT455299	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT455298	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT455297	hsa-miR-4784	PAR-CLIP	23592263
MIRT455296	hsa-miR-4419a	PAR-CLIP	23592263
MIRT455295	hsa-miR-4510	PAR-CLIP	23592263
MIRT455294	hsa-miR-6127	PAR-CLIP	23592263
MIRT455293	hsa-miR-6129	PAR-CLIP	23592263
MIRT455292	hsa-miR-6130	PAR-CLIP	23592263
MIRT455291	hsa-miR-6133	PAR-CLIP	23592263
MIRT455290	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT455289	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT455288	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT455287	hsa-miR-4710	PAR-CLIP	23592263
MIRT455286	hsa-miR-198	PAR-CLIP	23592263
MIRT455285	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT455284	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT455283	hsa-miR-1287-3p	PAR-CLIP	23592263
MIRT455282	hsa-miR-4689	PAR-CLIP	23592263
MIRT455281	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT441111	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441111	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT004285	hsa-miR-491-5p	Luciferase reporter assay	24747968
MIRT731772	hsa-miR-133b	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	26276722
MIRT731772	hsa-miR-133b	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	26276722
MIRT052647	hsa-miR-133a-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	26276722
MIRT052647	hsa-miR-133a-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	26276722
MIRT528157	hsa-miR-324-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27245778
MIRT455289	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT455289	hsa-miR-1249-5p	PAR-CLIP	26701625
MIRT455283	hsa-miR-1287-3p	PAR-CLIP	26701625
MIRT455283	hsa-miR-1287-3p	PAR-CLIP	26701625
MIRT455286	hsa-miR-198	PAR-CLIP	26701625
MIRT455286	hsa-miR-198	PAR-CLIP	26701625
MIRT455298	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT455298	hsa-miR-3150b-3p	PAR-CLIP	26701625
MIRT455301	hsa-miR-4257	PAR-CLIP	26701625
MIRT455301	hsa-miR-4257	PAR-CLIP	26701625
MIRT455296	hsa-miR-4419a	PAR-CLIP	26701625
MIRT455296	hsa-miR-4419a	PAR-CLIP	26701625
MIRT455296	hsa-miR-4419a	PAR-CLIP	26701625
MIRT455295	hsa-miR-4510	PAR-CLIP	26701625
MIRT455295	hsa-miR-4510	PAR-CLIP	26701625
MIRT455295	hsa-miR-4510	PAR-CLIP	26701625
MIRT455299	hsa-miR-455-3p	PAR-CLIP	26701625
MIRT455299	hsa-miR-455-3p	PAR-CLIP	26701625
MIRT455303	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT455303	hsa-miR-4676-5p	PAR-CLIP	26701625
MIRT455282	hsa-miR-4689	PAR-CLIP	26701625
MIRT455282	hsa-miR-4689	PAR-CLIP	26701625
MIRT455287	hsa-miR-4710	PAR-CLIP	26701625
MIRT455287	hsa-miR-4710	PAR-CLIP	26701625
MIRT455300	hsa-miR-4779	PAR-CLIP	26701625
MIRT455300	hsa-miR-4779	PAR-CLIP	26701625
MIRT455297	hsa-miR-4784	PAR-CLIP	26701625
MIRT455297	hsa-miR-4784	PAR-CLIP	26701625
MIRT455285	hsa-miR-520a-5p	PAR-CLIP	26701625
MIRT455285	hsa-miR-520a-5p	PAR-CLIP	26701625
MIRT455284	hsa-miR-525-5p	PAR-CLIP	26701625
MIRT455284	hsa-miR-525-5p	PAR-CLIP	26701625
MIRT455302	hsa-miR-575	PAR-CLIP	26701625
MIRT455302	hsa-miR-575	PAR-CLIP	26701625
MIRT455294	hsa-miR-6127	PAR-CLIP	26701625
MIRT455294	hsa-miR-6127	PAR-CLIP	26701625
MIRT455294	hsa-miR-6127	PAR-CLIP	26701625
MIRT455293	hsa-miR-6129	PAR-CLIP	26701625
MIRT455293	hsa-miR-6129	PAR-CLIP	26701625
MIRT455293	hsa-miR-6129	PAR-CLIP	26701625
MIRT455292	hsa-miR-6130	PAR-CLIP	26701625
MIRT455292	hsa-miR-6130	PAR-CLIP	26701625
MIRT455292	hsa-miR-6130	PAR-CLIP	26701625
MIRT455291	hsa-miR-6133	PAR-CLIP	26701625
MIRT455291	hsa-miR-6133	PAR-CLIP	26701625
MIRT455291	hsa-miR-6133	PAR-CLIP	26701625
MIRT455288	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT455288	hsa-miR-6797-5p	PAR-CLIP	26701625
MIRT455304	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT455304	hsa-miR-6858-3p	PAR-CLIP	26701625
MIRT455281	hsa-miR-6858-5p	PAR-CLIP	26701625
MIRT455281	hsa-miR-6858-5p	PAR-CLIP	26701625
MIRT455290	hsa-miR-7854-3p	PAR-CLIP	26701625
MIRT455290	hsa-miR-7854-3p	PAR-CLIP	26701625
MIRT732574	hsa-miR-1269a	Microarray, qRT-PCR	34258170
MIRT732576	hsa-miR-193b-3p	Microarray, qRT-PCR	34258170
MIRT734463	hsa-miR-663b	ELISA, Flow cytometry, Luciferase reporter assay, qRT-PCR, Western blotting	32346421
MIRT528165	hsa-miR-449b-3p	PAR-CLIP	22012620
MIRT528164	hsa-miR-4691-3p	PAR-CLIP	22012620
MIRT528163	hsa-miR-361-3p	PAR-CLIP	22012620
MIRT528162	hsa-miR-4722-3p	PAR-CLIP	22012620
MIRT528161	hsa-miR-6727-3p	PAR-CLIP	22012620
MIRT528160	hsa-miR-6747-3p	PAR-CLIP	22012620
MIRT528159	hsa-miR-1976	PAR-CLIP	22012620
MIRT528158	hsa-miR-1913	PAR-CLIP	22012620
MIRT528157	hsa-miR-324-3p	PAR-CLIP	22012620
MIRT528156	hsa-miR-4313	PAR-CLIP	22012620
MIRT528155	hsa-miR-587	PAR-CLIP	22012620
MIRT528154	hsa-miR-4749-3p	PAR-CLIP	22012620
MIRT455304	hsa-miR-6858-3p	PAR-CLIP	23592263
MIRT455303	hsa-miR-4676-5p	PAR-CLIP	23592263
MIRT455302	hsa-miR-575	PAR-CLIP	23592263
MIRT455300	hsa-miR-4779	PAR-CLIP	23592263
MIRT455301	hsa-miR-4257	PAR-CLIP	23592263
MIRT455299	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT455298	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT455297	hsa-miR-4784	PAR-CLIP	23592263
MIRT455296	hsa-miR-4419a	PAR-CLIP	23592263
MIRT455295	hsa-miR-4510	PAR-CLIP	23592263
MIRT455294	hsa-miR-6127	PAR-CLIP	23592263
MIRT455293	hsa-miR-6129	PAR-CLIP	23592263
MIRT455292	hsa-miR-6130	PAR-CLIP	23592263
MIRT455291	hsa-miR-6133	PAR-CLIP	23592263
MIRT455290	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT455289	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT455288	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT455287	hsa-miR-4710	PAR-CLIP	23592263
MIRT455286	hsa-miR-198	PAR-CLIP	23592263
MIRT455285	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT455284	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT455283	hsa-miR-1287-3p	PAR-CLIP	23592263
MIRT455282	hsa-miR-4689	PAR-CLIP	23592263
MIRT455281	hsa-miR-6858-5p	PAR-CLIP	23592263
MIRT818887	hsa-miR-1252	CLIP-seq
MIRT818888	hsa-miR-1255a	CLIP-seq
MIRT818889	hsa-miR-1255b	CLIP-seq
MIRT818890	hsa-miR-1275	CLIP-seq
MIRT818891	hsa-miR-1276	CLIP-seq
MIRT818892	hsa-miR-2110	CLIP-seq
MIRT818893	hsa-miR-3150a-3p	CLIP-seq
MIRT818894	hsa-miR-3151	CLIP-seq
MIRT818895	hsa-miR-3175	CLIP-seq
MIRT818896	hsa-miR-3202	CLIP-seq
MIRT818897	hsa-miR-331-3p	CLIP-seq
MIRT818898	hsa-miR-342-5p	CLIP-seq
MIRT818899	hsa-miR-3591-5p	CLIP-seq
MIRT818900	hsa-miR-3649	CLIP-seq
MIRT818901	hsa-miR-3662	CLIP-seq
MIRT818902	hsa-miR-377	CLIP-seq
MIRT818903	hsa-miR-4271	CLIP-seq
MIRT818904	hsa-miR-4303	CLIP-seq
MIRT818905	hsa-miR-4314	CLIP-seq
MIRT818906	hsa-miR-4325	CLIP-seq
MIRT818907	hsa-miR-4447	CLIP-seq
MIRT818908	hsa-miR-4450	CLIP-seq
MIRT818909	hsa-miR-4472	CLIP-seq
MIRT818910	hsa-miR-4481	CLIP-seq
MIRT818911	hsa-miR-4487	CLIP-seq
MIRT818912	hsa-miR-4533	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT818914	hsa-miR-4664-5p	CLIP-seq
MIRT818915	hsa-miR-4665-5p	CLIP-seq
MIRT818916	hsa-miR-4667-5p	CLIP-seq
MIRT818917	hsa-miR-4668-5p	CLIP-seq
MIRT818918	hsa-miR-4693-3p	CLIP-seq
MIRT818919	hsa-miR-4700-5p	CLIP-seq
MIRT818920	hsa-miR-4725-3p	CLIP-seq
MIRT818921	hsa-miR-4726-3p	CLIP-seq
MIRT818922	hsa-miR-4745-5p	CLIP-seq
MIRT818923	hsa-miR-4766-5p	CLIP-seq
MIRT818924	hsa-miR-4793-3p	CLIP-seq
MIRT818925	hsa-miR-5096	CLIP-seq
MIRT818926	hsa-miR-554	CLIP-seq
MIRT818927	hsa-miR-570	CLIP-seq
MIRT818928	hsa-miR-595	CLIP-seq
MIRT818929	hsa-miR-607	CLIP-seq
MIRT818930	hsa-miR-625	CLIP-seq
MIRT818931	hsa-miR-637	CLIP-seq
MIRT818932	hsa-miR-648	CLIP-seq
MIRT818933	hsa-miR-939	CLIP-seq
MIRT818934	hsa-miR-1251	CLIP-seq
MIRT818891	hsa-miR-1276	CLIP-seq
MIRT818935	hsa-miR-1909	CLIP-seq
MIRT818896	hsa-miR-3202	CLIP-seq
MIRT818902	hsa-miR-377	CLIP-seq
MIRT818936	hsa-miR-4270	CLIP-seq
MIRT818903	hsa-miR-4271	CLIP-seq
MIRT818937	hsa-miR-4300	CLIP-seq
MIRT818938	hsa-miR-4441	CLIP-seq
MIRT818939	hsa-miR-4475	CLIP-seq
MIRT818920	hsa-miR-4725-3p	CLIP-seq
MIRT818940	hsa-miR-4733-5p	CLIP-seq
MIRT818941	hsa-miR-4747-5p	CLIP-seq
MIRT818929	hsa-miR-607	CLIP-seq
MIRT818942	hsa-miR-920	CLIP-seq
MIRT818887	hsa-miR-1252	CLIP-seq
MIRT1941983	hsa-miR-1257	CLIP-seq
MIRT1941984	hsa-miR-1293	CLIP-seq
MIRT818892	hsa-miR-2110	CLIP-seq
MIRT1941985	hsa-miR-2113	CLIP-seq
MIRT1941986	hsa-miR-2276	CLIP-seq
MIRT1941987	hsa-miR-296-3p	CLIP-seq
MIRT1941988	hsa-miR-3074-3p	CLIP-seq
MIRT1941989	hsa-miR-3074-5p	CLIP-seq
MIRT1941990	hsa-miR-3127-5p	CLIP-seq
MIRT818894	hsa-miR-3151	CLIP-seq
MIRT818896	hsa-miR-3202	CLIP-seq
MIRT1941991	hsa-miR-342-3p	CLIP-seq
MIRT818898	hsa-miR-342-5p	CLIP-seq
MIRT1941992	hsa-miR-3545-3p	CLIP-seq
MIRT818899	hsa-miR-3591-5p	CLIP-seq
MIRT1941993	hsa-miR-3622b-5p	CLIP-seq
MIRT1941994	hsa-miR-3665	CLIP-seq
MIRT1941995	hsa-miR-3936	CLIP-seq
MIRT1941996	hsa-miR-3945	CLIP-seq
MIRT1941997	hsa-miR-3975	CLIP-seq
MIRT1941998	hsa-miR-412	CLIP-seq
MIRT1941999	hsa-miR-4253	CLIP-seq
MIRT818936	hsa-miR-4270	CLIP-seq
MIRT818903	hsa-miR-4271	CLIP-seq
MIRT818904	hsa-miR-4303	CLIP-seq
MIRT818905	hsa-miR-4314	CLIP-seq
MIRT818938	hsa-miR-4441	CLIP-seq
MIRT818907	hsa-miR-4447	CLIP-seq
MIRT1942000	hsa-miR-4452	CLIP-seq
MIRT1942001	hsa-miR-4471	CLIP-seq
MIRT818909	hsa-miR-4472	CLIP-seq
MIRT1942002	hsa-miR-4483	CLIP-seq
MIRT1942003	hsa-miR-4520a-3p	CLIP-seq
MIRT818912	hsa-miR-4533	CLIP-seq
MIRT1942004	hsa-miR-4539	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT818914	hsa-miR-4664-5p	CLIP-seq
MIRT1942005	hsa-miR-4667-3p	CLIP-seq
MIRT818916	hsa-miR-4667-5p	CLIP-seq
MIRT818919	hsa-miR-4700-5p	CLIP-seq
MIRT818920	hsa-miR-4725-3p	CLIP-seq
MIRT818921	hsa-miR-4726-3p	CLIP-seq
MIRT1942006	hsa-miR-4736	CLIP-seq
MIRT818923	hsa-miR-4766-5p	CLIP-seq
MIRT1942007	hsa-miR-4804-3p	CLIP-seq
MIRT1942008	hsa-miR-495	CLIP-seq
MIRT1942009	hsa-miR-498	CLIP-seq
MIRT1942010	hsa-miR-541	CLIP-seq
MIRT1942011	hsa-miR-548an	CLIP-seq
MIRT818926	hsa-miR-554	CLIP-seq
MIRT1942012	hsa-miR-555	CLIP-seq
MIRT818927	hsa-miR-570	CLIP-seq
MIRT818928	hsa-miR-595	CLIP-seq
MIRT818930	hsa-miR-625	CLIP-seq
MIRT818931	hsa-miR-637	CLIP-seq
MIRT818932	hsa-miR-648	CLIP-seq
MIRT1942013	hsa-miR-654-5p	CLIP-seq
MIRT1942014	hsa-miR-767-5p	CLIP-seq
MIRT2180784	hsa-let-7a	CLIP-seq
MIRT2180785	hsa-let-7b	CLIP-seq
MIRT2180786	hsa-let-7c	CLIP-seq
MIRT2180787	hsa-let-7d	CLIP-seq
MIRT2180788	hsa-let-7e	CLIP-seq
MIRT2180789	hsa-let-7f	CLIP-seq
MIRT2180790	hsa-let-7g	CLIP-seq
MIRT2180791	hsa-let-7i	CLIP-seq
MIRT2180792	hsa-miR-1226	CLIP-seq
MIRT1941983	hsa-miR-1257	CLIP-seq
MIRT818891	hsa-miR-1276	CLIP-seq
MIRT2180793	hsa-miR-202	CLIP-seq
MIRT2180794	hsa-miR-22	CLIP-seq
MIRT1941986	hsa-miR-2276	CLIP-seq
MIRT1941988	hsa-miR-3074-3p	CLIP-seq
MIRT1941989	hsa-miR-3074-5p	CLIP-seq
MIRT2180795	hsa-miR-3140-5p	CLIP-seq
MIRT818894	hsa-miR-3151	CLIP-seq
MIRT818896	hsa-miR-3202	CLIP-seq
MIRT1941991	hsa-miR-342-3p	CLIP-seq
MIRT818898	hsa-miR-342-5p	CLIP-seq
MIRT1941992	hsa-miR-3545-3p	CLIP-seq
MIRT2180796	hsa-miR-3667-5p	CLIP-seq
MIRT2180797	hsa-miR-3681	CLIP-seq
MIRT2180798	hsa-miR-3689a-5p	CLIP-seq
MIRT2180799	hsa-miR-3689b	CLIP-seq
MIRT2180800	hsa-miR-3689e	CLIP-seq
MIRT2180801	hsa-miR-3689f	CLIP-seq
MIRT2180802	hsa-miR-371-5p	CLIP-seq
MIRT818902	hsa-miR-377	CLIP-seq
MIRT2180803	hsa-miR-3939	CLIP-seq
MIRT1941998	hsa-miR-412	CLIP-seq
MIRT2180804	hsa-miR-4267	CLIP-seq
MIRT818936	hsa-miR-4270	CLIP-seq
MIRT2180805	hsa-miR-4293	CLIP-seq
MIRT818904	hsa-miR-4303	CLIP-seq
MIRT818906	hsa-miR-4325	CLIP-seq
MIRT818938	hsa-miR-4441	CLIP-seq
MIRT818907	hsa-miR-4447	CLIP-seq
MIRT1942000	hsa-miR-4452	CLIP-seq
MIRT2180806	hsa-miR-4457	CLIP-seq
MIRT2180807	hsa-miR-4458	CLIP-seq
MIRT1942001	hsa-miR-4471	CLIP-seq
MIRT818909	hsa-miR-4472	CLIP-seq
MIRT818939	hsa-miR-4475	CLIP-seq
MIRT818911	hsa-miR-4487	CLIP-seq
MIRT2180808	hsa-miR-4500	CLIP-seq
MIRT1942004	hsa-miR-4539	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT2180809	hsa-miR-4661-5p	CLIP-seq
MIRT818914	hsa-miR-4664-5p	CLIP-seq
MIRT818916	hsa-miR-4667-5p	CLIP-seq
MIRT2180810	hsa-miR-4690-3p	CLIP-seq
MIRT818919	hsa-miR-4700-5p	CLIP-seq
MIRT2180811	hsa-miR-4708-3p	CLIP-seq
MIRT2180812	hsa-miR-4724-5p	CLIP-seq
MIRT2180813	hsa-miR-4725-5p	CLIP-seq
MIRT2180814	hsa-miR-4777-5p	CLIP-seq
MIRT818924	hsa-miR-4793-3p	CLIP-seq
MIRT1942009	hsa-miR-498	CLIP-seq
MIRT2180815	hsa-miR-504	CLIP-seq
MIRT818925	hsa-miR-5096	CLIP-seq
MIRT2180816	hsa-miR-513b	CLIP-seq
MIRT2180817	hsa-miR-518d-5p	CLIP-seq
MIRT2180818	hsa-miR-519b-5p	CLIP-seq
MIRT2180819	hsa-miR-519c-5p	CLIP-seq
MIRT2180820	hsa-miR-520c-5p	CLIP-seq
MIRT2180821	hsa-miR-526a	CLIP-seq
MIRT2180822	hsa-miR-544b	CLIP-seq
MIRT2180823	hsa-miR-548ac	CLIP-seq
MIRT2180824	hsa-miR-548ae	CLIP-seq
MIRT2180825	hsa-miR-548aj	CLIP-seq
MIRT2180826	hsa-miR-548am	CLIP-seq
MIRT2180827	hsa-miR-548d-3p	CLIP-seq
MIRT2180828	hsa-miR-548x	CLIP-seq
MIRT2180829	hsa-miR-548z	CLIP-seq
MIRT818927	hsa-miR-570	CLIP-seq
MIRT818928	hsa-miR-595	CLIP-seq
MIRT818929	hsa-miR-607	CLIP-seq
MIRT818931	hsa-miR-637	CLIP-seq
MIRT2180830	hsa-miR-7	CLIP-seq
MIRT2180831	hsa-miR-98	CLIP-seq
MIRT818907	hsa-miR-4447	CLIP-seq
MIRT818909	hsa-miR-4472	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT818916	hsa-miR-4667-5p	CLIP-seq
MIRT818919	hsa-miR-4700-5p	CLIP-seq
MIRT2444747	hsa-miR-1827	CLIP-seq
MIRT2444748	hsa-miR-4316	CLIP-seq
MIRT2444749	hsa-miR-4476	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT2180784	hsa-let-7a	CLIP-seq
MIRT2180785	hsa-let-7b	CLIP-seq
MIRT2180786	hsa-let-7c	CLIP-seq
MIRT2180787	hsa-let-7d	CLIP-seq
MIRT2180788	hsa-let-7e	CLIP-seq
MIRT2180789	hsa-let-7f	CLIP-seq
MIRT2180790	hsa-let-7g	CLIP-seq
MIRT2180791	hsa-let-7i	CLIP-seq
MIRT2484220	hsa-miR-103a	CLIP-seq
MIRT2484221	hsa-miR-107	CLIP-seq
MIRT2484222	hsa-miR-1200	CLIP-seq
MIRT818934	hsa-miR-1251	CLIP-seq
MIRT818888	hsa-miR-1255a	CLIP-seq
MIRT818889	hsa-miR-1255b	CLIP-seq
MIRT2484223	hsa-miR-1266	CLIP-seq
MIRT2484224	hsa-miR-1291	CLIP-seq
MIRT1941984	hsa-miR-1293	CLIP-seq
MIRT2484225	hsa-miR-133a	CLIP-seq
MIRT2444747	hsa-miR-1827	CLIP-seq
MIRT2180793	hsa-miR-202	CLIP-seq
MIRT2484226	hsa-miR-204	CLIP-seq
MIRT2484227	hsa-miR-211	CLIP-seq
MIRT2484228	hsa-miR-214	CLIP-seq
MIRT2484229	hsa-miR-296-5p	CLIP-seq
MIRT2484230	hsa-miR-3064-3p	CLIP-seq
MIRT1941988	hsa-miR-3074-3p	CLIP-seq
MIRT1941989	hsa-miR-3074-5p	CLIP-seq
MIRT2484231	hsa-miR-3120-5p	CLIP-seq
MIRT1941990	hsa-miR-3127-5p	CLIP-seq
MIRT2180795	hsa-miR-3140-5p	CLIP-seq
MIRT2484232	hsa-miR-3155	CLIP-seq
MIRT2484233	hsa-miR-3155b	CLIP-seq
MIRT2484234	hsa-miR-3162-3p	CLIP-seq
MIRT818896	hsa-miR-3202	CLIP-seq
MIRT2484235	hsa-miR-328	CLIP-seq
MIRT2484236	hsa-miR-330-5p	CLIP-seq
MIRT818897	hsa-miR-331-3p	CLIP-seq
MIRT2484237	hsa-miR-3619-5p	CLIP-seq
MIRT818900	hsa-miR-3649	CLIP-seq
MIRT2484238	hsa-miR-3667-3p	CLIP-seq
MIRT2180796	hsa-miR-3667-5p	CLIP-seq
MIRT2484239	hsa-miR-3677-5p	CLIP-seq
MIRT2180802	hsa-miR-371-5p	CLIP-seq
MIRT2484240	hsa-miR-3907	CLIP-seq
MIRT2484241	hsa-miR-3918	CLIP-seq
MIRT1941998	hsa-miR-412	CLIP-seq
MIRT818936	hsa-miR-4270	CLIP-seq
MIRT818903	hsa-miR-4271	CLIP-seq
MIRT2484242	hsa-miR-4278	CLIP-seq
MIRT2484243	hsa-miR-4281	CLIP-seq
MIRT2484244	hsa-miR-4283	CLIP-seq
MIRT2484245	hsa-miR-4287	CLIP-seq
MIRT2180805	hsa-miR-4293	CLIP-seq
MIRT818937	hsa-miR-4300	CLIP-seq
MIRT2484246	hsa-miR-431	CLIP-seq
MIRT2444748	hsa-miR-4316	CLIP-seq
MIRT2484247	hsa-miR-4326	CLIP-seq
MIRT2484248	hsa-miR-4438	CLIP-seq
MIRT818938	hsa-miR-4441	CLIP-seq
MIRT2484249	hsa-miR-4446-3p	CLIP-seq
MIRT818908	hsa-miR-4450	CLIP-seq
MIRT2180806	hsa-miR-4457	CLIP-seq
MIRT2180807	hsa-miR-4458	CLIP-seq
MIRT818939	hsa-miR-4475	CLIP-seq
MIRT2444749	hsa-miR-4476	CLIP-seq
MIRT1942002	hsa-miR-4483	CLIP-seq
MIRT2484250	hsa-miR-4489	CLIP-seq
MIRT2180808	hsa-miR-4500	CLIP-seq
MIRT2484251	hsa-miR-4518	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT2484252	hsa-miR-4656	CLIP-seq
MIRT818916	hsa-miR-4667-5p	CLIP-seq
MIRT2484253	hsa-miR-4685-3p	CLIP-seq
MIRT2180810	hsa-miR-4690-3p	CLIP-seq
MIRT2484254	hsa-miR-4690-5p	CLIP-seq
MIRT2484255	hsa-miR-4694-3p	CLIP-seq
MIRT818919	hsa-miR-4700-5p	CLIP-seq
MIRT2484256	hsa-miR-4716-3p	CLIP-seq
MIRT818920	hsa-miR-4725-3p	CLIP-seq
MIRT2180813	hsa-miR-4725-5p	CLIP-seq
MIRT818940	hsa-miR-4733-5p	CLIP-seq
MIRT818941	hsa-miR-4747-5p	CLIP-seq
MIRT2484257	hsa-miR-4796-3p	CLIP-seq
MIRT2484258	hsa-miR-4797-3p	CLIP-seq
MIRT1942007	hsa-miR-4804-3p	CLIP-seq
MIRT2484259	hsa-miR-486-3p	CLIP-seq
MIRT1942008	hsa-miR-495	CLIP-seq
MIRT2180815	hsa-miR-504	CLIP-seq
MIRT818925	hsa-miR-5096	CLIP-seq
MIRT2180816	hsa-miR-513b	CLIP-seq
MIRT2484260	hsa-miR-522	CLIP-seq
MIRT2180822	hsa-miR-544b	CLIP-seq
MIRT2180823	hsa-miR-548ac	CLIP-seq
MIRT2180824	hsa-miR-548ae	CLIP-seq
MIRT2180825	hsa-miR-548aj	CLIP-seq
MIRT2180826	hsa-miR-548am	CLIP-seq
MIRT2180827	hsa-miR-548d-3p	CLIP-seq
MIRT2484261	hsa-miR-548t	CLIP-seq
MIRT2180828	hsa-miR-548x	CLIP-seq
MIRT2180829	hsa-miR-548z	CLIP-seq
MIRT818926	hsa-miR-554	CLIP-seq
MIRT2484262	hsa-miR-635	CLIP-seq
MIRT818931	hsa-miR-637	CLIP-seq
MIRT2484263	hsa-miR-643	CLIP-seq
MIRT2180830	hsa-miR-7	CLIP-seq
MIRT2484264	hsa-miR-760	CLIP-seq
MIRT2484265	hsa-miR-761	CLIP-seq
MIRT818942	hsa-miR-920	CLIP-seq
MIRT2484266	hsa-miR-938	CLIP-seq
MIRT2180831	hsa-miR-98	CLIP-seq
MIRT2180784	hsa-let-7a	CLIP-seq
MIRT2180785	hsa-let-7b	CLIP-seq
MIRT2180786	hsa-let-7c	CLIP-seq
MIRT2180787	hsa-let-7d	CLIP-seq
MIRT2180788	hsa-let-7e	CLIP-seq
MIRT2180789	hsa-let-7f	CLIP-seq
MIRT2180790	hsa-let-7g	CLIP-seq
MIRT2180791	hsa-let-7i	CLIP-seq
MIRT2484220	hsa-miR-103a	CLIP-seq
MIRT2484221	hsa-miR-107	CLIP-seq
MIRT2484222	hsa-miR-1200	CLIP-seq
MIRT818934	hsa-miR-1251	CLIP-seq
MIRT2484223	hsa-miR-1266	CLIP-seq
MIRT2484224	hsa-miR-1291	CLIP-seq
MIRT2484225	hsa-miR-133a	CLIP-seq
MIRT2444747	hsa-miR-1827	CLIP-seq
MIRT2180793	hsa-miR-202	CLIP-seq
MIRT2484226	hsa-miR-204	CLIP-seq
MIRT2484227	hsa-miR-211	CLIP-seq
MIRT2484228	hsa-miR-214	CLIP-seq
MIRT2484229	hsa-miR-296-5p	CLIP-seq
MIRT2484230	hsa-miR-3064-3p	CLIP-seq
MIRT1941988	hsa-miR-3074-3p	CLIP-seq
MIRT1941989	hsa-miR-3074-5p	CLIP-seq
MIRT2484231	hsa-miR-3120-5p	CLIP-seq
MIRT1941990	hsa-miR-3127-5p	CLIP-seq
MIRT2180795	hsa-miR-3140-5p	CLIP-seq
MIRT2484232	hsa-miR-3155	CLIP-seq
MIRT2484233	hsa-miR-3155b	CLIP-seq
MIRT2484234	hsa-miR-3162-3p	CLIP-seq
MIRT818896	hsa-miR-3202	CLIP-seq
MIRT2484235	hsa-miR-328	CLIP-seq
MIRT2484236	hsa-miR-330-5p	CLIP-seq
MIRT2484237	hsa-miR-3619-5p	CLIP-seq
MIRT2484238	hsa-miR-3667-3p	CLIP-seq
MIRT2180796	hsa-miR-3667-5p	CLIP-seq
MIRT2484239	hsa-miR-3677-5p	CLIP-seq
MIRT2180802	hsa-miR-371-5p	CLIP-seq
MIRT2484241	hsa-miR-3918	CLIP-seq
MIRT1941998	hsa-miR-412	CLIP-seq
MIRT818936	hsa-miR-4270	CLIP-seq
MIRT818903	hsa-miR-4271	CLIP-seq
MIRT2484242	hsa-miR-4278	CLIP-seq
MIRT2484243	hsa-miR-4281	CLIP-seq
MIRT2484244	hsa-miR-4283	CLIP-seq
MIRT2484245	hsa-miR-4287	CLIP-seq
MIRT2180805	hsa-miR-4293	CLIP-seq
MIRT818937	hsa-miR-4300	CLIP-seq
MIRT2484246	hsa-miR-431	CLIP-seq
MIRT2444748	hsa-miR-4316	CLIP-seq
MIRT2484247	hsa-miR-4326	CLIP-seq
MIRT2484248	hsa-miR-4438	CLIP-seq
MIRT818938	hsa-miR-4441	CLIP-seq
MIRT2484249	hsa-miR-4446-3p	CLIP-seq
MIRT2180806	hsa-miR-4457	CLIP-seq
MIRT2180807	hsa-miR-4458	CLIP-seq
MIRT818939	hsa-miR-4475	CLIP-seq
MIRT2444749	hsa-miR-4476	CLIP-seq
MIRT2484250	hsa-miR-4489	CLIP-seq
MIRT2180808	hsa-miR-4500	CLIP-seq
MIRT2484251	hsa-miR-4518	CLIP-seq
MIRT818913	hsa-miR-4649-3p	CLIP-seq
MIRT2484252	hsa-miR-4656	CLIP-seq
MIRT818916	hsa-miR-4667-5p	CLIP-seq
MIRT2484253	hsa-miR-4685-3p	CLIP-seq
MIRT2180810	hsa-miR-4690-3p	CLIP-seq
MIRT2484254	hsa-miR-4690-5p	CLIP-seq
MIRT2484255	hsa-miR-4694-3p	CLIP-seq
MIRT818919	hsa-miR-4700-5p	CLIP-seq
MIRT2484256	hsa-miR-4716-3p	CLIP-seq
MIRT818920	hsa-miR-4725-3p	CLIP-seq
MIRT2180813	hsa-miR-4725-5p	CLIP-seq
MIRT818940	hsa-miR-4733-5p	CLIP-seq
MIRT818941	hsa-miR-4747-5p	CLIP-seq
MIRT2484257	hsa-miR-4796-3p	CLIP-seq
MIRT2484258	hsa-miR-4797-3p	CLIP-seq
MIRT1942007	hsa-miR-4804-3p	CLIP-seq
MIRT2484259	hsa-miR-486-3p	CLIP-seq
MIRT1942008	hsa-miR-495	CLIP-seq
MIRT2180815	hsa-miR-504	CLIP-seq
MIRT818925	hsa-miR-5096	CLIP-seq
MIRT2180816	hsa-miR-513b	CLIP-seq
MIRT2484260	hsa-miR-522	CLIP-seq
MIRT2180822	hsa-miR-544b	CLIP-seq
MIRT2180823	hsa-miR-548ac	CLIP-seq
MIRT2180824	hsa-miR-548ae	CLIP-seq
MIRT2180825	hsa-miR-548aj	CLIP-seq
MIRT2180826	hsa-miR-548am	CLIP-seq
MIRT2180827	hsa-miR-548d-3p	CLIP-seq
MIRT2484261	hsa-miR-548t	CLIP-seq
MIRT2180828	hsa-miR-548x	CLIP-seq
MIRT2180829	hsa-miR-548z	CLIP-seq
MIRT818926	hsa-miR-554	CLIP-seq
MIRT2484262	hsa-miR-635	CLIP-seq
MIRT818931	hsa-miR-637	CLIP-seq
MIRT2484263	hsa-miR-643	CLIP-seq
MIRT2180830	hsa-miR-7	CLIP-seq
MIRT2484264	hsa-miR-760	CLIP-seq
MIRT2484265	hsa-miR-761	CLIP-seq
MIRT818942	hsa-miR-920	CLIP-seq
MIRT2484266	hsa-miR-938	CLIP-seq
MIRT2180831	hsa-miR-98	CLIP-seq

Transcription factors

Show/Hide all(23)

Transcription factor	Regulation	Reference
BCL6	Repression	11777915
CEBPB	Unknown	19043455
FOS	Unknown	16911523
JUN	Unknown	16911523
MTA1	Activation	11948399
NFKB1	Activation	12226754;14978135;15756023;15856023;15986355;16904634;18223231;20066113
NFKB1	Repression	15231833
NFKB1	Unknown	10733571;10925251;12176906;14739605;16453001;17673602;18222423
NR1I2	Activation	16085054
NUPR1	Activation	18690848
PAX3	Activation	10871843
PPARG	Repression	14960510
RELA	Activation	12226754;14978135;15756023;15856023;15986355;16904634;18223231;20066113;20585448
RELA	Repression	15231833
RELA	Unknown	10733571;10925251;14739605;16453001;17673602
SREBF1	Repression	16091421
STAT3	Activation	11369651;15184887;15805299;16651438;17880940;20069389;21435102
STAT3	Repression	20067773
STAT3	Unknown	15469392;16384639;18222423;18790750;20654581;21172343;21344490
STAT5A	Unknown	11756417
STAT5B	Activation	20585448
TP53	Activation	9000137
TP53	Repression	18172861

Show/Hide all(100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IBA
GO:0001836	Process	Release of cytochrome c from mitochondria	IDA	9843949
GO:0001836	Process	Release of cytochrome c from mitochondria	IEA
GO:0005515	Function	Protein binding	IPI	9027312, 9388232, 9660918, 10837489, 11054413, 11060313, 11126360, 11278245, 11463391, 11714801, 11971963, 12011449, 12667443, 12815463, 14596824, 14739602, 14752512, 14963330, 15031724, 15110758, 15131699, 15694340, 15901672, 16151013, 16189514, 16509771, 16608847, 16697956, 171776
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	20673843
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	12011449
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	10365962
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	19767770
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	NAS	12667443
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005813	Component	Centrosome	IDA	21840391
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006950	Process	Response to stress	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007281	Process	Germ cell development	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0008637	Process	Apoptotic mitochondrial changes	TAS	9393856
GO:0009314	Process	Response to radiation	IEA
GO:0009566	Process	Fertilization	IEA
GO:0009615	Process	Response to virus	IEA
GO:0010507	Process	Negative regulation of autophagy	TAS	18309324
GO:0015267	Function	Channel activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	21840391
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032465	Process	Regulation of cytokinesis	IMP	21840391
GO:0032946	Process	Positive regulation of mononuclear cell proliferation	IEA
GO:0034097	Process	Response to cytokine	IDA	9184696
GO:0035234	Process	Ectopic germ cell programmed cell death	IEA
GO:0040008	Process	Regulation of growth	IEA
GO:0042802	Function	Identical protein binding	IPI	15131699, 21856303
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	7650367
GO:0043066	Process	Negative regulation of apoptotic process	IDA	9388232, 12667443, 21567405
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	17289999
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044565	Process	Dendritic cell proliferation	IEA
GO:0045202	Component	Synapse	IEA
GO:0046898	Process	Response to cycloheximide	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IDA	9843949
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0051093	Process	Negative regulation of developmental process	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051434	Function	BH3 domain binding	IPI	15901672, 21639858
GO:0051607	Process	Defense response to virus	IDA	17428862
GO:0051707	Process	Response to other organism	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IDA	9843949
GO:0055085	Process	Transmembrane transport	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071312	Process	Cellular response to alkaloid	IEA
GO:0071480	Process	Cellular response to gamma radiation	IEA
GO:0071839	Process	Apoptotic process in bone marrow cell	IEA
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IC	21041309
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IDA	9393856, 15901672
GO:0097048	Process	Dendritic cell apoptotic process	IEA
GO:0097136	Component	Bcl-2 family protein complex	IDA	21199865
GO:0097136	Component	Bcl-2 family protein complex	IEA
GO:0097136	Component	Bcl-2 family protein complex	IPI	21856303, 22515821
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IBA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097284	Process	Hepatocyte apoptotic process	IEA
GO:1900118	Process	Negative regulation of execution phase of apoptosis	IDA	20673843
GO:1901029	Process	Negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IDA	9393856, 15901672
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	26582200
GO:1902230	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IDA	16608847
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	29507230
GO:1902531	Process	Regulation of intracellular signal transduction	IEA
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IDA	21041309
GO:2000242	Process	Negative regulation of reproductive process	IEA
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IEA
GO:2000811	Process	Negative regulation of anoikis	IMP	15006356
GO:2001233	Process	Regulation of apoptotic signaling pathway	IEA
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	TAS	8358789
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IDA	12011449, 21567405

MIM	HGNC	e!Ensembl
600039	992	ENSG00000171552

Protein

UniProt ID

Q07817

Protein name

Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)

Protein function

Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochond

PDB

1BXL , 1G5J , 1LXL , 1MAZ , 1R2D , 1R2E , 1R2G , 1R2H , 1R2I , 1YSG , 1YSI , 1YSN , 2B48 , 2LP8 , 2LPC , 2M03 , 2M04 , 2ME8 , 2ME9 , 2MEJ , 2O1Y , 2O2M , 2O2N , 2P1L , 2PON , 2YJ1 , 2YQ6 , 2YQ7 , 2YXJ , 3CVA , 3FDL , 3FDM , 3INQ , 3IO8 , 3PL7 , 3QKD , 3R85 , 3SP7 , 3SPF , 3WIZ , 3ZK6 , 3ZLN , 3ZLO , 3ZLR , 4A1U , 4A1W , 4AQ3 , 4BPK , 4C52 , 4C5D , 4CIN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02180	BH4	1 → 26	Bcl-2 homology region 4	Family
PF00452	Bcl-2	90 → 188	Apoptosis regulator proteins, Bcl-2 family	Family

Tissue specificity

TISSUE SPECIFICITY: Bcl-X(S) is expressed at high levels in cells that undergo a high rate of turnover, such as developing lymphocytes. In contrast, Bcl-X(L) is found in tissues containing long-lived postmitotic cells, such as adult brain.

Sequence

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK

Sequence length

233

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance Platinum drug resistance Ras signaling pathway NF-kappa B signaling pathway p53 signaling pathway Mitophagy - animal Autophagy - animal PI3K-Akt signaling pathway Apoptosis Apoptosis - multiple species NOD-like receptor signaling pathway JAK-STAT signaling pathway Parkinson disease Amyotrophic lateral sclerosis Pathways of neurodegeneration - multiple diseases Shigellosis Toxoplasmosis Measles Human T-cell leukemia virus 1 infection Herpes simplex virus 1 infection Human immunodeficiency virus 1 infection Pathways in cancer Transcriptional misregulation in cancer Pancreatic cancer Chronic myeloid leukemia Small cell lung cancer Hepatocellular carcinoma Lipid and atherosclerosis		BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members Interleukin-4 and Interleukin-13 signaling The NLRP1 inflammasome

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Hypertension	Hypertension (confirmatory factor analysis Factor 12)	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (274)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Coronary Syndrome	Associate	23535507
Acute erythroleukemia	Associate	24451410
Acute Kidney Injury	Associate	12118096
Adenocarcinoma	Stimulate	15484295
Adenocarcinoma	Associate	15700269, 29991802
Adenocarcinoma of Lung	Associate	14614329, 19139118, 24339958, 25034693, 26001295, 26860078, 30497474, 37619315
Adenoma	Stimulate	10944610, 26048755, 34126796
Altitude Sickness	Associate	29176544
Alveolitis Extrinsic Allergic	Associate	12608434
Alzheimer Disease	Stimulate	17712163
Amyotrophic Lateral Sclerosis	Associate	33167591
Anemia Aplastic	Associate	11380462
Anemia Refractory	Associate	11090080, 12111784
Anemia Sickle Cell	Associate	31648320
Aneuploidy	Associate	27398719
Anodontia	Associate	11313274
Anodontia	Stimulate	16042757
Aortic Aneurysm Thoracic	Associate	22978789
Arthritis Psoriatic	Associate	7747803
Arthritis Rheumatoid	Associate	36243930, 40045304
Astrocytoma	Associate	35977048
Ataxia Telangiectasia	Associate	11133771
Atrial Fibrillation	Associate	33706714
Barrett Esophagus	Associate	16049281
Behcet Syndrome	Associate	15986355
Bipolar Disorder	Inhibit	28463235
Blood Platelet Disorders	Associate	21562047, 32388279
Bloom Syndrome	Associate	32073752
Bone Marrow Diseases	Associate	12937123
Brain Neoplasms	Associate	37586773
Breast Neoplasms	Associate	10507761, 11278482, 12210599, 12381725, 12884026, 15100288, 16080463, 18428028, 20089431, 20164027, 20829044, 23934044, 24359639, 24745479, 24909179 View all (12 more)
Breast Neoplasms	Stimulate	12644829
Breast Neoplasms	Inhibit	19047049
Burkitt Lymphoma	Associate	19136942, 22241218
Carcinogenesis	Associate	18494061, 21647677, 26385919
Carcinoma Basal Cell	Associate	7747803
Carcinoma Endometrioid	Associate	26299454
Carcinoma Hepatocellular	Associate	11572758, 12439925, 15063116, 16750275, 17033717, 21829603, 22928777, 23392177, 24779770, 26194347, 26259250, 27579319, 28081730, 29425759, 33576217, 34258170 View all (1 more)
Carcinoma Hepatocellular	Stimulate	16640784
Carcinoma Non Small Cell Lung	Associate	11828291, 15700269, 18281471, 21880871, 22522453, 24339958, 26668309, 26959116, 27264345, 27519412, 29321496, 30250075, 31150457, 32705266
Carcinoma Non Small Cell Lung	Inhibit	28855578
Carcinoma Non Small Cell Lung	Stimulate	8630278
Carcinoma Ovarian Epithelial	Associate	29949791, 31210304, 34071938
Carcinoma Pancreatic Ductal	Associate	29409480, 35684936, 36422202
Carcinoma Renal Cell	Associate	33850477, 35121737, 35776130
Carcinoma Small Cell	Associate	12871776
Carcinoma Verrucous	Associate	29652014
Cardiomyopathies	Associate	32631246
Cell Transformation Viral	Inhibit	12111784
Central Nervous System Neoplasms	Associate	22357666
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Associate	16794010
Cholangiocarcinoma	Associate	11729212, 30880771, 35983950
Chondrosarcoma	Stimulate	17343283
Chondrosarcoma	Associate	19445670, 20661931, 23415961, 34070455
Chordoma	Associate	24621885
Chromosomal Instability	Associate	27398719
Chronic Disease	Stimulate	21262580
Colonic Neoplasms	Stimulate	10965024
Colonic Neoplasms	Associate	18494061
Colonic Polyps	Associate	34126796
Colorectal Neoplasms	Associate	10193519, 10965024, 11290547, 11896073, 14520471, 15314290, 15770735, 16127422, 16192633, 16608847, 18200666, 18494061, 18609706, 24098503, 25156145 View all (23 more)
Colorectal Neoplasms	Stimulate	15162527
Common Variable Immunodeficiency	Associate	10844530, 26081581, 30464201, 32961586
Congenital contractural arachnodactyly	Associate	35983950
Congenital myasthenic syndrome ib	Associate	27821551
Continuous Muscle Fiber Activity Hereditary	Associate	11570908
Corneal dystrophy Avellino type	Associate	19497990
Corneal Endothelial Cell Loss	Associate	24217227
Coronary Disease	Associate	33964876
COVID 19	Associate	32344305, 35240314
Cystic Fibrosis	Associate	23135964
Death	Associate	18670645, 21704149, 26722503
Death	Stimulate	36326498
Dermatitis Atopic	Associate	12605696
Diabetes Mellitus Type 1	Associate	22519592
Disease	Associate	24401183, 27821551, 30614804, 31808877, 33017468
Disease Resistance	Associate	9642215
DNA Virus Infections	Associate	21068357, 32630281
Down Syndrome	Associate	25222269, 33633844
Drug Related Side Effects and Adverse Reactions	Associate	16405512, 17218385, 21320495, 24651037, 24911215, 25482938, 26022120, 27519412
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Associate	16684963
Emanuel syndrome	Associate	37729611
Endometrial Neoplasms	Associate	20178603, 28421904
Endometriosis	Associate	17094974
Epstein Barr Virus Infections	Stimulate	16611410
Esophageal Neoplasms	Associate	12439908, 17167836, 37500660
Esophageal Squamous Cell Carcinoma	Associate	25438156
Familial Primary Pulmonary Hypertension	Associate	21037114
Fatigue	Associate	24786901
Fatty Liver Alcoholic	Stimulate	29425759
Fever	Associate	25156145, 35371275
Fibrosarcoma	Associate	12637494
Fibrosis	Associate	22928777
Gastrointestinal Neoplasms	Associate	11788897, 27194951
Gingival Diseases	Associate	31743516, 33934404
Glioblastoma	Associate	12558990, 15611130, 17699103, 18786178, 20153921, 21880871, 23908595, 23965755, 25482938, 25633526, 25793261, 26775694, 31323961, 31751869, 34209035, 35167936, 35473984 View all (2 more)
Glioma	Associate	10408397, 15611130, 18662322, 18670645, 19289490, 19861406, 21279667, 22406992, 25674231, 27805285, 31319814, 34643804, 36273072, 9060818, 9576951
Glomerulonephritis IGA	Associate	26460503, 29137483
Glomerulonephritis Membranous	Inhibit	16109447
Glomerulonephritis Membranous	Associate	17911631
Glomerulosclerosis Focal Segmental	Associate	29137483
Glucocorticoid Receptor Deficiency	Associate	26715915
Glycogen Storage Disease IIIA	Associate	30269021
Head and Neck Neoplasms	Associate	24019973, 32710568
Heart Diseases	Associate	23535507
Heart Failure	Associate	10841223
Hematologic Neoplasms	Associate	26537004, 27742710, 28038464
Hemochromatosis	Associate	15245439
Hemolytic Uremic Syndrome	Associate	9840908
Hepatitis Alcoholic	Associate	29425759
Hepatitis B	Associate	10520003, 36077449
Hepatitis C	Associate	25648321
Hereditary leiomyomatosis and renal cell cancer	Associate	12393683, 16960154, 16962107
HIV Infections	Inhibit	17162379
HIV Infections	Associate	31719184, 33980597, 35891449
Hodgkin Disease	Associate	12393683, 29693141, 7742524
Hyperoxia	Inhibit	21128858
Hyperphosphatemia	Inhibit	21858050
Hypersensitivity Immediate	Associate	14966904
Hypophosphatemia	Stimulate	21858050
Hypothyroidism Congenital Nongoitrous 2	Associate	17094974
Hypoxia	Associate	11880298, 18670645, 19161638, 19211554, 20164027, 22984526, 23289374, 27821551
Hypoxia	Inhibit	23681233
Hypoxia	Stimulate	30949212, 34181359
Hypoxia Brain	Stimulate	20661931
Idiopathic Pulmonary Fibrosis	Associate	30481203
Immunoglobulin Light chain Amyloidosis	Stimulate	36694297
Infections	Inhibit	16861905
Infections	Associate	30680725
Infections	Stimulate	33980597
Inflammation	Associate	11570908, 25222269
Intestinal Diseases	Associate	14966904
Iron Overload	Inhibit	31838956
Kidney Neoplasms	Associate	35776130, 35984355
Laryngeal Neoplasms	Associate	15928664, 18427001, 23775802
Leiomyoma	Associate	16962107
Leiomyosarcoma	Associate	27140314
Leukemia	Associate	11369651, 11880365, 22016818, 23445492, 25088254, 29545342, 34824248, 37078252, 8611710
Leukemia Erythroblastic Acute	Associate	8611710
Leukemia Large Granular Lymphocytic	Associate	17162379
Leukemia Lymphocytic Chronic B Cell	Associate	10754513, 15521917, 18796631, 19008458, 19164937, 22184378, 24778183, 25829398, 26537004, 27177607, 27189785, 32581054, 32603412, 34467417, 35418613, 36550750, 37439352 View all (2 more)
Leukemia Lymphocytic Chronic B Cell	Inhibit	12580957
Leukemia Lymphoma Adult T Cell	Associate	15638862
Leukemia Megakaryoblastic Acute	Associate	23874683
Leukemia Monocytic Acute	Associate	37904054
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	10727459, 19109573, 22033489, 26431162, 26629937, 32241082
Leukemia Myeloid	Associate	10648417, 22898820
Leukemia Myeloid Acute	Associate	10845930, 22016818, 23798675, 24451410, 25308513, 25714024, 26188358, 26801919, 27283158, 32021103, 37078252, 37904054, 9562974
Leukemia Myelomonocytic Chronic	Stimulate	12111784
Leukemia Prolymphocytic T Cell	Associate	20813004, 29767411, 9450802
Leukemia Promyelocytic Acute	Associate	25514379
Leukemia T Cell	Stimulate	10891462
Lewy Body Disease	Associate	31666070
Liver Cirrhosis	Associate	27579319
Lung Neoplasms	Associate	14614329, 15753661, 22675468, 23894143, 30497474, 31595832, 8630278
Lupus Erythematosus Systemic	Inhibit	37993903
Lymphatic Metastasis	Stimulate	18494061, 25550772
Lymphatic Metastasis	Associate	20430737
Lymphedema Hereditary IB	Associate	12210808
Lymphoma	Associate	12969962, 17938578, 25590803, 27742710
Lymphoma B Cell	Associate	17681667, 22155272, 26537004, 33307035, 34861096
Lymphoma Follicular	Associate	12969962, 14767488, 18606651, 19242522, 21240256, 32898249, 37824846, 9414291
Lymphoma Follicular	Stimulate	7742524
Lymphoma Large B Cell Diffuse	Associate	11835337, 15073604, 15517919, 21625222, 31801186, 32708132
Lymphoma Large Cell Anaplastic	Associate	11485911, 15858125, 35058488
Lymphoma Non Hodgkin	Associate	11835337, 12944556, 14978135, 16081784, 17938578, 21826062, 8686741
Lymphoma Non Hodgkin	Inhibit	9802885
Lymphoma T Cell	Associate	11133771, 15656903, 32388279
Lymphopenia	Associate	16048439
Malignant mesenchymal tumor	Associate	35776130
Mammary Neoplasms Animal	Associate	16127422
Mastocytoma	Stimulate	12937123
Mastocytosis	Associate	12937123
Mastocytosis Cutaneous	Associate	12937123
Medulloblastoma	Associate	35315927, 37898609, 9060818
Melanoma	Associate	11874491, 15314285, 17384650, 18079751, 18222423, 19838163, 21637003, 22685558, 22705850, 26035829, 29183729, 31019203
Melanoma Cutaneous Malignant	Associate	19626699
Meningeal Carcinomatosis	Associate	29652014
Mesothelioma	Associate	17224645, 31786278
Mesothelioma Malignant	Associate	12063468, 19815709, 22734486, 25408576
Mitochondrial Diseases	Inhibit	11461904, 22354970
Mitochondrial Diseases	Associate	15494423, 20223826, 25268613, 26043078, 28038320, 29240261, 35977048, 37055388, 9354463
Monoclonal Gammopathy of Undetermined Significance	Associate	24816239
Mouth Neoplasms	Associate	29652014
Multiple Myeloma	Associate	10583232, 10979940, 11175262, 11468182, 12707028, 15970928, 17332241, 18443271, 18544087, 21659544, 21826062, 21871133, 22177381, 24816239, 27465916 View all (10 more)
Muscular Dystrophy Duchenne	Associate	34922439
Myelodysplastic Syndromes	Associate	12111784, 31838956, 9886323
Myeloproliferative Disorders	Associate	19109573, 26290261
Myositis Inclusion Body	Associate	11570908
Myotonic Dystrophy	Associate	37468473
Nasopharyngeal Carcinoma	Associate	31566021, 34064109, 37217794
Neoplasm Metastasis	Associate	20164027, 21637003, 36077449, 36254394
Neoplasm Metastasis	Stimulate	8623925
Neoplasms	Associate	10935471, 11278482, 11290547, 11485911, 11486001, 11720445, 12381725, 12439908, 12633850, 14563949, 15100288, 15928664, 16080514, 16081848, 16288204 View all (101 more)
Neoplasms	Stimulate	10944610, 16049281, 17384650, 19211554, 25659096, 26048755, 33144684
Neoplasms	Inhibit	26915294, 28038320, 33123872, 36433652
Neoplasms Squamous Cell	Associate	22852863
Nephrotic Syndrome	Associate	27997540
Nerve Degeneration	Associate	12186923, 22388478
Neuroblastoma	Associate	11796751, 21159604, 21878749, 32203216
Neurofibroma	Associate	24346802
Neurofibrosarcoma	Associate	24346802
Neuropathy Hereditary Sensory And Autonomic Type I With Cough And Gastroesophageal Reflux	Associate	28937296
Neutropenia	Associate	10607719
Nevus Pigmented	Associate	12535197
Non Muscle Invasive Bladder Neoplasms	Associate	30875757
Oncogene Addiction	Associate	21292770
Ornithine Carbamoyltransferase Deficiency Disease	Associate	33550136
Oropharyngeal Neoplasms	Associate	18474878
Osteoarthritis	Associate	32255771, 33953899
Osteoporosis	Associate	26273425
Osteosarcoma	Associate	10702275, 26416351, 26569226, 27735939, 28618955, 31799646
Ovarian Neoplasms	Associate	10679744, 17575110, 19517469, 22098591, 23277286, 23573264, 24523919, 24650799, 25299770, 25627260, 26063499, 27080533, 27415751, 31462500, 32424251, 36122664 View all (1 more)
Pancreatic Neoplasms	Associate	14583775, 16109447, 21174186, 21720559, 22471280, 22609401, 23426533, 23519249, 23954445, 27941651, 29596435, 31412018, 31467029, 35315913, 36422202, 9860477 View all (1 more)
Parkinson Disease	Associate	31710912
Pelvic Organ Prolapse	Associate	21674599
Pituitary Neoplasms	Inhibit	10079254
Polycythemia	Associate	27821551
Polycythemia Vera	Associate	16684963, 19060244, 19109573, 20625010, 9475763
Polycythemia Vera	Stimulate	32790151
Polyps	Associate	34126796
Post Acute COVID 19 Syndrome	Associate	36890149
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	15684603, 27997540, 37363966, 9108419
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	12139741
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	21080944, 21575156, 35734930, 36902436, 37302808, 37363966, 38066918
Primary Myelofibrosis	Associate	22300941
Primary Myelofibrosis	Stimulate	32790151
Primary Ovarian Insufficiency	Associate	40696610
Prostatic Neoplasms	Associate	11571633, 12381725, 12496481, 12633850, 12738789, 15314206, 16052512, 16794010, 19211554, 21310825, 22484941, 23047795, 27590631, 30141307, 30198376, 31389670, 32630281 View all (2 more)
Prostatic Neoplasms Castration Resistant	Associate	19646263, 31228231, 37047425
Prostatitis	Associate	12655519, 16794010, 17699103, 9141489
Prostatitis	Stimulate	19211554
Psoriasis	Associate	7747803
Pulmonary Disease Chronic Obstructive	Associate	22686245
Purpura Thrombocytopenic Idiopathic	Associate	20671119
Purpura Thrombocytopenic Idiopathic	Inhibit	27734765
Rectal Diseases	Associate	37387515
Rectal Neoplasms	Associate	22171132
Respiratory Sounds	Associate	37053215
Retinal Dysplasia	Stimulate	16049281
Retinoblastoma	Associate	26730174
Ring Chromosome 20 Syndrome	Associate	31808877
Ring Chromosomes	Stimulate	12111784
Sarcoma Kaposi	Associate	11687955
Sarcoma Synovial	Associate	35887198
Sepsis	Stimulate	36443881
Sjogren's Syndrome	Associate	30662920
Sleep Deprivation	Inhibit	10935471
Small Cell Lung Carcinoma	Associate	16810323, 21965726, 26722503, 32152266
Small Cell Lung Carcinoma	Stimulate	8630278
Squamous Cell Carcinoma of Head and Neck	Associate	15917659, 17848273, 17971900, 18566236, 25139387, 25550772, 28877725, 29652014, 30614804, 30635792, 31575007, 31894587, 32710568, 35078428, 35887198
Stomach Neoplasms	Associate	12944556, 16077903, 21777278, 24838641, 37271936, 37794689
Tertiary Lymphoid Structures	Associate	20430737
Thrombocythemia Essential	Associate	22300941
Thrombocythemia Essential	Stimulate	32790151
Thrombocytopenia	Associate	22184378, 25333252, 35058488
Thrombocytopenia	Stimulate	27080533
Thymoma	Associate	34781947
Thyroid Neoplasms	Associate	16452205
Tongue Neoplasms	Stimulate	25550772
Triple Negative Breast Neoplasms	Associate	26045046, 30482844, 34903710, 36077449, 36381235
Tuberculosis Multidrug Resistant	Associate	24637737
Urethral Neoplasms	Associate	22685613, 29312470
Urinary Bladder Neoplasms	Associate	18751404, 21408190, 22797576, 23749114, 24459064, 34868059, 37511611
Uterine Cervical Neoplasms	Associate	21593790, 27886335
Uveal melanoma	Associate	22653968
Varicose Ulcer	Associate	21262580
Vascular System Injuries	Associate	24217227
Virus Diseases	Associate	22928777
Vitiligo	Associate	33790887, 36890149
Waldenstrom Macroglobulinemia	Associate	25893290
WHIM syndrome	Associate	10607719
Wilms Tumor	Associate	11720445
Wounds and Injuries	Stimulate	36243930

BCL2L1 (BCL2 like 1)