Gene Gene information from NCBI Gene database.
Entrez ID 598
Gene name BCL2 like 1
Gene symbol BCL2L1
Synonyms (NCBI Gene)
BCL-XL/SBCL2LBCLXBcl-XPPP1R52
Chromosome 20
Chromosome location 20q11.21
Summary The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gen
miRNA miRNA information provided by mirtarbase database.
572
miRTarBase ID miRNA Experiments Reference
MIRT004285 hsa-miR-491-5p Luciferase reporter assayWestern blot 20039318
MIRT004490 hsa-let-7g-5p Luciferase reporter assayqRT-PCRWestern blot 20347499
MIRT004491 hsa-let-7c-5p Luciferase reporter assayqRT-PCRWestern blot 20347499
MIRT004491 hsa-let-7c-5p Luciferase reporter assayqRT-PCRWestern blot 22917031
MIRT004491 hsa-let-7c-5p Luciferase reporter assayqRT-PCRWestern blot 22917031
Transcription factors Transcription factors information provided by TRRUST V2 database.
23
Transcription factor Regulation Reference
BCL6 Repression 11777915
CEBPB Unknown 19043455
FOS Unknown 16911523
JUN Unknown 16911523
MTA1 Activation 11948399
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
100
GO ID Ontology Definition Evidence Reference
GO:0001541 Process Ovarian follicle development IEA
GO:0001701 Process In utero embryonic development IEA
GO:0001836 Process Release of cytochrome c from mitochondria IBA
GO:0001836 Process Release of cytochrome c from mitochondria IDA 9843949
GO:0001836 Process Release of cytochrome c from mitochondria IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600039 992 ENSG00000171552
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q07817
Protein name Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)
Protein function Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochond
PDB 1BXL , 1G5J , 1LXL , 1MAZ , 1R2D , 1R2E , 1R2G , 1R2H , 1R2I , 1YSG , 1YSI , 1YSN , 2B48 , 2LP8 , 2LPC , 2M03 , 2M04 , 2ME8 , 2ME9 , 2MEJ , 2O1Y , 2O2M , 2O2N , 2P1L , 2PON , 2YJ1 , 2YQ6 , 2YQ7 , 2YXJ , 3CVA , 3FDL , 3FDM , 3INQ , 3IO8 , 3PL7 , 3QKD , 3R85 , 3SP7 , 3SPF , 3WIZ , 3ZK6 , 3ZLN , 3ZLO , 3ZLR , 4A1U , 4A1W , 4AQ3 , 4BPK , 4C52 , 4C5D , 4CIN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02180 BH4 1 26 Bcl-2 homology region 4 Family
PF00452 Bcl-2 90 188 Apoptosis regulator proteins, Bcl-2 family Family
Tissue specificity TISSUE SPECIFICITY: Bcl-X(S) is expressed at high levels in cells that undergo a high rate of turnover, such as developing lymphocytes. In contrast, Bcl-X(L) is found in tissues containing long-lived postmitotic cells, such as adult brain.
Sequence
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGW
DTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Sequence length 233
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  EGFR tyrosine kinase inhibitor resistance
Platinum drug resistance
Ras signaling pathway
NF-kappa B signaling pathway
p53 signaling pathway
Mitophagy - animal
Autophagy - animal
PI3K-Akt signaling pathway
Apoptosis
Apoptosis - multiple species
NOD-like receptor signaling pathway
JAK-STAT signaling pathway
Parkinson disease
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
Shigellosis
Toxoplasmosis
Measles
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Pancreatic cancer
Chronic myeloid leukemia
Small cell lung cancer
Hepatocellular carcinoma
Lipid and atherosclerosis
  BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
Interleukin-4 and Interleukin-13 signaling
The NLRP1 inflammasome
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hereditary breast ovarian cancer syndrome Uncertain significance rs2122387594 RCV001374576
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 23535507
Acute erythroleukemia Associate 24451410
Acute Kidney Injury Associate 12118096
Adenocarcinoma Stimulate 15484295
Adenocarcinoma Associate 15700269, 29991802
Adenocarcinoma of Lung Associate 14614329, 19139118, 24339958, 25034693, 26001295, 26860078, 30497474, 37619315
Adenoma Stimulate 10944610, 26048755, 34126796
Altitude Sickness Associate 29176544
Alveolitis Extrinsic Allergic Associate 12608434
Alzheimer Disease Stimulate 17712163