Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5977
Gene name Gene Name - the full gene name approved by the HGNC.
Double PHD fingers 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DPF2
Synonyms (NCBI Gene) Gene synonyms aliases
CSS7, REQ, SMARCG2, UBID4, ubi-d4
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the d4 domain family, characterized by a zinc finger-like structural motif. This protein functions as a transcription factor which is necessary for the apoptotic response following deprivation of survival fa
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1555031372 G>T Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs1555031500 C>G Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs1555032044 A>G Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs1555032051 G>A Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs1555032074 G>A Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022792 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT032431 hsa-let-7b-5p Proteomics 18668040
MIRT615267 hsa-miR-3126-3p HITS-CLIP 23824327
MIRT615266 hsa-miR-6752-3p HITS-CLIP 23824327
MIRT615265 hsa-miR-5088-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 28533407
GO:0000785 Component Chromatin HDA 16217013
GO:0000785 Component Chromatin IDA 28533407
GO:0000785 Component Chromatin NAS 12192000
GO:0003714 Function Transcription corepressor activity TAS 28533407
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601671 9964 ENSG00000133884
Protein
UniProt ID Q92785
Protein name Zinc finger protein ubi-d4 (Apoptosis response zinc finger protein) (BRG1-associated factor 45D) (BAF45D) (D4, zinc and double PHD fingers family 2) (Protein requiem)
Protein function Plays an active role in transcriptional regulation by binding modified histones H3 and H4 (PubMed:27775714, PubMed:28533407). Is a negative regulator of myeloid differentiation of hematopoietic progenitor cells (PubMed:28533407). Might also have
PDB 3IUF , 5B79 , 5VDC , 6LTH , 6LTJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14051 Requiem_N 13 84 N-terminal domain of DPF2/REQ. Family
PF00628 PHD 272 330 PHD-finger Domain
PF00628 PHD 329 376 PHD-finger Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKR
HRGPGLASGQLYSYPARRWRKKRR
AHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLE
ALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRR
GKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGED
KEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGR
SGHPSCLQFTPVMMAAVKTYRWQCIECK
CCNICGTSENDDQLLFCDDCDRGYHMYCLTPS
MSEPPEGSWSCHLCLD
LLKEKASIYQNQNSS
Sequence length 391
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  ATP-dependent chromatin remodeling  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Coffin-Siris Syndrome Coffin-Siris syndrome 1 rs1555031372 N/A
Coffin-Siris syndrome coffin-siris syndrome 7 rs1555031372, rs1555031500, rs1555032051, rs1555032044, rs1555032074 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholism Associate 28981154
Coffin Siris syndrome Associate 34180430
Glioblastoma Associate 29373718
Glioma Associate 29373718
Leukemia Myeloid Acute Inhibit 28533407