Gene Gene information from NCBI Gene database.
Entrez ID 597
Gene name BCL2 related protein A1
Gene symbol BCL2A1
Synonyms (NCBI Gene)
ACC-1ACC-2ACC1ACC2BCL2L5BFL1GRSHBPA1
Chromosome 15
Chromosome location 15q25.1
Summary This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeosta
miRNA miRNA information provided by mirtarbase database.
6
miRTarBase ID miRNA Experiments Reference
MIRT017218 hsa-miR-335-5p Microarray 18185580
MIRT021264 hsa-miR-146a-5p Microarray 18057241
MIRT818591 hsa-miR-182 CLIP-seq
MIRT818592 hsa-miR-3074-3p CLIP-seq
MIRT818593 hsa-miR-4704-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
7
Transcription factor Regulation Reference
HDAC1 Activation 17000776
MITF Repression 23447565
NFKB1 Activation 11880364;12665576;19343319
NFKB1 Unknown 10733571;17000776
REL Activation 11880364
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0001836 Process Release of cytochrome c from mitochondria IBA
GO:0005515 Function Protein binding IPI 10753914, 16697956, 17428862, 25416956, 31515488, 32296183, 34245648
GO:0005737 Component Cytoplasm IDA 34245648
GO:0005737 Component Cytoplasm IEA
GO:0005741 Component Mitochondrial outer membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601056 991 ENSG00000140379
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16548
Protein name Bcl-2-related protein A1 (Bcl-2-like protein 5) (Bcl2-L-5) (Hemopoietic-specific early response protein) (Protein BFL-1) (Protein GRS)
Protein function Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection (By similarity). Can inhibit apoptosis induced by serum starvation in t
PDB 2VM6 , 3I1H , 3MQP , 4ZEQ , 5UUK , 5UUL , 5UUP , 5WHH , 5WHI , 6E3I , 6E3J , 6MBB , 6MBC , 6RJP , 6VO4 , 8RPO , 9FKY , 9FKZ , 9FL0 , 9GIP , 9GIQ , 9GIR , 9GIS , 9GIT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00452 Bcl-2 37 140 Apoptosis regulator proteins, Bcl-2 family Family
Tissue specificity TISSUE SPECIFICITY: Seems to be restricted to the hematopoietic compartment. Expressed in peripheral blood, spleen, and bone marrow, at moderate levels in lung, small intestine and testis, at a minimal levels in other tissues. Also found in vascular smoot
Sequence
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGW
ENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
Sequence length 175
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  NF-kappa B signaling pathway
Apoptosis
Transcriptional misregulation in cancer
Acute myeloid leukemia
 
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
4
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign rs112191286 RCV005906212
Gastric cancer Benign rs112191286 RCV005906213
Thymoma Benign rs112191286 RCV005906214
Uterine corpus endometrial carcinoma Benign rs112191286 RCV005906215
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 9488635
Acute Coronary Syndrome Associate 23535507
Airway Obstruction Associate 36171630
alpha Thalassemia Associate 11074535, 14508795, 14978697, 15329491, 25730315, 3337900, 6255436, 6894931, 8781536
alpha Thalassemia Stimulate 25730315
Anemia Associate 28011635
Anemia Sickle Cell Associate 14978697, 24599433, 8781536
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis Associate 22403660
Aortic Aneurysm Associate 2243125
Aortic Aneurysm Familial Thoracic 1 Associate 2243125