Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5966
Gene name Gene Name - the full gene name approved by the HGNC.
REL proto-oncogene, NF-kB subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
REL
Synonyms (NCBI Gene) Gene synonyms aliases
C-Rel, HIVEN86A, IMD92
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p16.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that belongs to the Rel homology domain/immunoglobulin-like fold, plexin, transcription factor (RHD/IPT) family. Members of this family regulate genes involved in apoptosis, inflammation, the immune response, and oncogenic proc
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027520 hsa-miR-98-5p Microarray 19088304
MIRT700231 hsa-miR-4802-3p HITS-CLIP 23313552
MIRT700230 hsa-miR-371b-3p HITS-CLIP 23313552
MIRT700229 hsa-miR-3688-3p HITS-CLIP 23313552
MIRT700228 hsa-miR-4716-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 1406630
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
164910 9954 ENSG00000162924
Protein
UniProt ID Q04864
Protein name Proto-oncogene c-Rel
Protein function Proto-oncogene that may play a role in differentiation and lymphopoiesis. NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, dif
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00554 RHD_DNA_bind 10 178 Rel homology DNA-binding domain Domain
PF16179 RHD_dimer 187 283 Rel homology dimerisation domain Domain
Sequence
MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII
TRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDN
RA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDE
KDTYGNKAKKQKTTLLF
QKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYF
KKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTP
RSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSA
DLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMS
SSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGI
GSMQNEQLSDSFPYEFFQV
Sequence length 619
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ras signaling pathway
Transcriptional misregulation in cancer
Viral carcinogenesis
  Activation of NF-kappaB in B cells
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dermatitis Atopic dermatitis N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Immunodeficiency Immunodeficiency 92, immunodeficiency 92 N/A N/A ClinVar, GenCC
Inflammatory Bowel Disease Inflammatory bowel disease (MTAG) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Psoriatic Associate 22328738
Arthritis Rheumatoid Associate 19503088, 24489016
Atherosclerosis Associate 15064395
Autoimmune Diseases Associate 36520934
Behcet Syndrome Associate 26784953
Breast Neoplasms Associate 29716623
Carcinogenesis Associate 23892589, 35887223
Carcinoma Ovarian Epithelial Associate 28206956
Carcinoma Pancreatic Ductal Associate 25299780
Carcinoma Squamous Cell Associate 23892589