Gene Gene information from NCBI Gene database.
Entrez ID 5954
Gene name Reticulocalbin 1
Gene symbol RCN1
Synonyms (NCBI Gene)
HEL-S-84PIG20RCALRCN
Chromosome 11
Chromosome location 11p13
Summary Reticulocalbin 1 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. High conservation of amino acid residues outside of these motifs
miRNA miRNA information provided by mirtarbase database.
370
miRTarBase ID miRNA Experiments Reference
MIRT025453 hsa-miR-34a-5p Proteomics 21566225
MIRT025453 hsa-miR-34a-5p Proteomics 21566225
MIRT1298338 hsa-miR-1245 CLIP-seq
MIRT1298339 hsa-miR-1297 CLIP-seq
MIRT1298340 hsa-miR-1305 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0001701 Process In utero embryonic development IEA
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005509 Function Calcium ion binding TAS 8416973
GO:0005515 Function Protein binding IPI 16713569, 32296183, 32814053, 36217030
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602735 9934 ENSG00000049449
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15293
Protein name Reticulocalbin-1
Protein function May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13202 EF-hand_5 208 233 EF hand Domain
PF13202 EF-hand_5 251 274 EF hand Domain
Sequence
MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDH
EAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNV
AKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADL
NGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGP
EPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKL
TKEEILENWNMFVGSQATNYGEDLTKNHDEL
Sequence length 331
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation