NPS (neuropeptide S)

Gene

• Entrez ID: 594857
• Gene name: Neuropeptide S
• Gene symbol: NPS
• Synonyms (NCBI Gene): -
• Chromosome: 10
• Chromosome location: 10q26.2

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0008542	Process	Visual learning	IEA
GO:0010841	Process	Positive regulation of circadian sleep/wake cycle, wakefulness	IEA
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	IBA
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	IEA
GO:0035249	Process	Synaptic transmission, glutamatergic	IEA
GO:0045202	Component	Synapse	IEA
GO:0045760	Process	Positive regulation of action potential	IBA
GO:0045760	Process	Positive regulation of action potential	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IBA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IEA

Other IDs

• MIM: 609513
• HGNC: 33940
• e!Ensembl: ENSG00000214285

Protein

• UniProt ID: P0C0P6
• Protein name: Neuropeptide S
• Protein function: Modulates arousal and anxiety. May play an important anorexigenic role (By similarity). Binds to its receptor NPSR1 with nanomolar affinity to increase intracellular calcium concentrations (PubMed:15312648, PubMed:16790440). {ECO:0000250, ECO:00
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14993	Neuropeptide_S	24 → 88	Neuropeptide S precursor protein	Family

• Sequence:

  MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKP
  ILEKMFVKRSFRNGVGTGMKKTSFQRAKS

• Sequence length: 89

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPOTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Anxiety	Associate	22216302, 24331455, 24386135, 33332443	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Associate	21525857, 25971599	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Associate	16790440, 24386135, 28463995	★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	38287231	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Associate	19732772	★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Associate	24386135	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammation	Associate	22216302	★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	30174554	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	24386135	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Associate	22158028	★☆☆☆☆ Found in Text Mining only
Mental Disorders	Associate	26865629	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24915894	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Associate	24915894	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	33332443	★☆☆☆☆ Found in Text Mining only
Obsessive Compulsive Disorder	Associate	23680103	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	22078257	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stiff Person Syndrome	Associate	22078257	★☆☆☆☆ Found in Text Mining only