Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5937
Gene name Gene Name - the full gene name approved by the HGNC.
RNA binding motif single stranded interacting protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RBMS1
Synonyms (NCBI Gene) Gene synonyms aliases
C2orf12, HCC-4, MSSP, MSSP-1, MSSP-2, MSSP-3, SCR2, YC1
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MSSP
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, origin
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005194 hsa-miR-30a-5p pSILAC 18668040
MIRT022190 hsa-miR-124-3p Microarray 15685193
MIRT022190 hsa-miR-124-3p Microarray 15685193
MIRT005194 hsa-miR-30a-5p Proteomics;Other 18668040
MIRT031782 hsa-miR-16-5p Proteomics 18668040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003690 Function Double-stranded DNA binding NAS 7838710
GO:0003697 Function Single-stranded DNA binding NAS 7838710
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IBA 21873635
GO:0003723 Function RNA binding NAS 8041632
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602310 9907 ENSG00000153250
Protein
UniProt ID P29558
Protein name RNA-binding motif, single-stranded-interacting protein 1 (Single-stranded DNA-binding protein MSSP-1) (Suppressor of CDC2 with RNA-binding motif 2)
Protein function Single-stranded DNA binding protein that interacts with the region upstream of the MYC gene. Binds specifically to the DNA sequence motif 5'-[AT]CT[AT][AT]T-3'. Probably has a role in DNA replication.
PDB 1X5O , 6M75 , 7C36
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 64 129 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 143 209 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Highest amounts are found in placenta, lung and heart.
Sequence
MGKVWKQQMYPQYATYYYPQYLQAKQSLVPAHPMAPPSPSTTSSNNNSSSSSNSGWDQLS
KTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAV
SALKASGVQ
AQMAKQQEQDPTNLYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTS
RGVGFARMESTEKCEAVIGHFNGKFIKTP
PGVSAPTEPLLCKFADGGQKKRQNPNKYIPN
GRPWHREGEVRLAGMTLTYDPTTAAIQNGFYPSPYSIATNRMITQTSITPYIASPVSAYQ
VQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLGSTGTYMPATS
AMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK
Sequence length 406
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
29358691, 20418489, 21647700, 30054458
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis GWAS
Carcinoma Carcinoma GWAS
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 36914816, 36989117
Colorectal Neoplasms Associate 37510319
Diabetes Mellitus Type 2 Associate 20418489, 22529894, 27193597, 30188962
Glioma Associate 40629190
Glut1 Deficiency Syndrome Inhibit 36902491
Hypoxia Inhibit 30556863, 30634531
Hypoxia Brain Associate 30634531, 32367141
Inflammation Inhibit 34295155
Insulin Resistance Associate 20418489
Neoplasms Associate 30634531, 36989117