RXFP1 (relaxin family peptide receptor 1)

Gene

• Entrez ID: 59350
• Gene name: Relaxin family peptide receptor 1
• Gene symbol: RXFP1
• Synonyms (NCBI Gene): LGR7, RXFPR1
• Chromosome: 4
• Chromosome location: 4q32.1
• Summary: This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane receptor superfamily. The encoded protein plays a critical role in sperm motility, pregnancy and parturition as a receptor for the protein h

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023171	hsa-miR-124-3p	Microarray	18668037
MIRT024094	hsa-miR-1-3p	Microarray	18668037
MIRT1323241	hsa-miR-3646	CLIP-seq
MIRT1323242	hsa-miR-3942-3p	CLIP-seq
MIRT1323243	hsa-miR-759	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IDA	11809971
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	20664520, 24014093
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007567	Process	Parturition	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0036446	Process	Myofibroblast differentiation	IEA
GO:0042562	Function	Hormone binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060427	Process	Lung connective tissue development	IEA
GO:0060658	Process	Nipple morphogenesis	IEA

Other IDs

• MIM: 606654
• HGNC: 19718
• e!Ensembl: ENSG00000171509

Protein

• UniProt ID: Q9HBX9
• Protein name: Relaxin receptor 1 (Leucine-rich repeat-containing G-protein coupled receptor 7) (Relaxin family peptide receptor 1)
• Protein function: Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a
• PDB: 2JM4, 2M7P, 7TMW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00057	Ldl_recept_a	25 → 62	Low-density lipoprotein receptor domain class A	Repeat
  PF13855	LRR_8	126 → 186	Leucine rich repeat	Repeat
  PF13855	LRR_8	175 → 234	Leucine rich repeat	Repeat
  PF13855	LRR_8	247 → 307	Leucine rich repeat	Repeat
  PF00001	7tm_1	422 → 681	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the brain, kidney, testis, placenta, uterus, ovary, adrenal, prostate, skin and heart. Not detected in spleen. {ECO:0000269|PubMed:16051677}.
• Sequence:

  MTSGSVFFYILIFGKYFSHGGGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADED
  NCGDNNGWSLQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRA
  VPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKITSISIYAFRGLNSLTKLY
  LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPPTFYGLNSLILLVLMNNVLTRLPDK
  PLCQHMPRLHWLDLEGNHIHNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDEL
  DLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQ
  RMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAVTC
  FGNIFVICMRPYIRSENKLYAMSIISLCCADCLMGIYLFVIGGFDLKFRGEYNKHAQLWM
  ESTHCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCVRPGKCRTITVLILIWITGF
  IVAFIPLSNKEFFKNYYGTNGVCFPLHSEDTESIGAQIYSVAIFLGINLAAFIIIVFSYG
  SMFYSVHQSAITATEIRNQVKKEMILAKRFFFIVFTDALCWIPIFVVKFLSLLQVEIPGT
  ITSWVVIFILPINSALNPILYTLTTRPFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWV
  EMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS

• Sequence length: 757

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Relaxin signaling pathway

Reactome:

G alpha (s) signalling events
Relaxin receptors
ADORA2B mediated anti-inflammatory cytokines production

<