Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
59343
Gene name Gene Name - the full gene name approved by the HGNC.
SUMO specific peptidase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SENP2
Synonyms (NCBI Gene) Gene synonyms aliases
AXAM2, SMT3IP2
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q27.2
Summary Summary of gene provided in NCBI Entrez Gene.
SUMO1 (UBL1; MIM 601912) is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-cont
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027689 hsa-miR-98-5p Microarray 19088304
MIRT047781 hsa-miR-30d-5p CLASH 23622248
MIRT1335729 hsa-let-7a CLIP-seq
MIRT1335730 hsa-let-7b CLIP-seq
MIRT1335731 hsa-let-7c CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 11896061, 15296745, 17099700, 20098747, 21965678, 25416956, 32296183, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005643 Component Nuclear pore IDA 12192048
GO:0005643 Component Nuclear pore IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608261 23116 ENSG00000163904
Protein
UniProt ID Q9HC62
Protein name Sentrin-specific protease 2 (EC 3.4.22.-) (Axam2) (SMT3-specific isopeptidase 2) (Smt3ip2) (Sentrin/SUMO-specific protease SENP2)
Protein function Protease that catalyzes two essential functions in the SUMO pathway (PubMed:11896061, PubMed:12192048, PubMed:15296745, PubMed:20194620, PubMed:21965678). The first is the hydrolysis of an alpha-linked peptide bond at the C-terminal end of the s
PDB 1TGZ , 1TH0 , 2IO0 , 2IO1 , 2IO2 , 2IO3 , 3ZO5 , 5AEK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02902 Peptidase_C48 409 588 Ulp1 protease family, C-terminal catalytic domain Domain
Sequence
MYRWLVRILGTIFRFCDRSVPPARALLKRRRSDSTLFSTVDTDEIPAKRPRLDCFIHQVK
NSLYNAASLFGFPFQLTTKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLG
NKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKP
QEQAVTEMISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGHGNSVCPVTSNYH
SSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTE
TMVGIRFENESRRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEKNCSGKERDR
RTDDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYM
NLLVERNKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWS
LVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIP
QQLNGSDCGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQL
L
Sequence length 589
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Nucleocytoplasmic transport
Wnt signaling pathway
  SUMO is proteolytically processed
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes, Type 2 diabetes (adjusted for BMI) N/A N/A GWAS
Gout Gout N/A N/A GWAS
Seborrheic dermatitis Seborrheic dermatitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 23874428
Breast Neoplasms Associate 24422630, 27178176, 29955155, 30732133
Carcinogenesis Associate 29955155
Carcinoma Hepatocellular Associate 23098437, 24969559
Carcinoma Squamous Cell Associate 24004673
Chromosome Aberrations Associate 21595939
Hypoxia Associate 30612578
Leukemia Lymphocytic Chronic B Cell Inhibit 30431078
Lymphatic Metastasis Associate 30732133
Multiple Myeloma Associate 31964975