Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5934
Gene name Gene Name - the full gene name approved by the HGNC.	RB transcriptional corepressor like 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RBL2
Synonyms (NCBI Gene) Gene synonyms aliases	BRUWAG, P130, Rb2
Disease Acronyms (UniProt) Disease acronyms from UniProt database	BRUWAG
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q12.2

Show/Hide all(169)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003218	kshv-miR-K12-4-5p	Luciferase reporter assay, Western blot	20071580
MIRT004139	hsa-miR-192-5p	Microarray	16822819
MIRT005852	hsa-miR-17-5p	Luciferase reporter assay	21283765
MIRT005859	hsa-miR-20a-5p	Luciferase reporter assay	21283765
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	21283765
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	23377830
MIRT019207	hsa-miR-335-5p	Microarray	18185580
MIRT005867	hsa-miR-106b-5p	Microarray	17242205
MIRT005859	hsa-miR-20a-5p	CLASH	23622248
MIRT005852	hsa-miR-17-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23250421
MIRT005852	hsa-miR-17-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23250421
MIRT005852	hsa-miR-17-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23250421
MIRT005852	hsa-miR-17-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23250421
MIRT143571	hsa-miR-106a-5p	Luciferase reporter assay	24045973
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT143571	hsa-miR-106a-5p	Luciferase reporter assay	24045973
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT143569	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT143605	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT143567	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT1294444	hsa-miR-101	CLIP-seq
MIRT1294445	hsa-miR-106a	CLIP-seq
MIRT1294446	hsa-miR-106b	CLIP-seq
MIRT1294447	hsa-miR-1229	CLIP-seq
MIRT1294448	hsa-miR-1253	CLIP-seq
MIRT1294449	hsa-miR-1254	CLIP-seq
MIRT1294450	hsa-miR-1292	CLIP-seq
MIRT1294451	hsa-miR-1324	CLIP-seq
MIRT1294452	hsa-miR-142-5p	CLIP-seq
MIRT1294453	hsa-miR-144	CLIP-seq
MIRT1294454	hsa-miR-17	CLIP-seq
MIRT1294455	hsa-miR-20a	CLIP-seq
MIRT1294456	hsa-miR-20b	CLIP-seq
MIRT1294457	hsa-miR-23a	CLIP-seq
MIRT1294458	hsa-miR-23b	CLIP-seq
MIRT1294459	hsa-miR-23c	CLIP-seq
MIRT1294460	hsa-miR-25	CLIP-seq
MIRT1294461	hsa-miR-302a	CLIP-seq
MIRT1294462	hsa-miR-302b	CLIP-seq
MIRT1294463	hsa-miR-302c	CLIP-seq
MIRT1294464	hsa-miR-302d	CLIP-seq
MIRT1294465	hsa-miR-302e	CLIP-seq
MIRT1294466	hsa-miR-3116	CLIP-seq
MIRT1294467	hsa-miR-3120-3p	CLIP-seq
MIRT1294468	hsa-miR-3130-3p	CLIP-seq
MIRT1294469	hsa-miR-3148	CLIP-seq
MIRT1294470	hsa-miR-3150a-3p	CLIP-seq
MIRT1294471	hsa-miR-3163	CLIP-seq
MIRT1294472	hsa-miR-3175	CLIP-seq
MIRT1294473	hsa-miR-32	CLIP-seq
MIRT1294474	hsa-miR-3202	CLIP-seq
MIRT1294475	hsa-miR-340	CLIP-seq
MIRT1294476	hsa-miR-363	CLIP-seq
MIRT1294477	hsa-miR-367	CLIP-seq
MIRT1294478	hsa-miR-3674	CLIP-seq
MIRT1294479	hsa-miR-372	CLIP-seq
MIRT1294480	hsa-miR-373	CLIP-seq
MIRT1294481	hsa-miR-377	CLIP-seq
MIRT1294482	hsa-miR-4272	CLIP-seq
MIRT1294483	hsa-miR-4274	CLIP-seq
MIRT1294484	hsa-miR-4282	CLIP-seq
MIRT1294485	hsa-miR-4293	CLIP-seq
MIRT1294486	hsa-miR-4420	CLIP-seq
MIRT1294487	hsa-miR-4424	CLIP-seq
MIRT1294488	hsa-miR-4519	CLIP-seq
MIRT1294489	hsa-miR-4533	CLIP-seq
MIRT1294490	hsa-miR-4653-3p	CLIP-seq
MIRT1294491	hsa-miR-4668-3p	CLIP-seq
MIRT1294492	hsa-miR-4668-5p	CLIP-seq
MIRT1294493	hsa-miR-4698	CLIP-seq
MIRT1294494	hsa-miR-4719	CLIP-seq
MIRT1294495	hsa-miR-4764-5p	CLIP-seq
MIRT1294496	hsa-miR-4790-3p	CLIP-seq
MIRT1294497	hsa-miR-519d	CLIP-seq
MIRT1294498	hsa-miR-520a-3p	CLIP-seq
MIRT1294499	hsa-miR-520b	CLIP-seq
MIRT1294500	hsa-miR-520c-3p	CLIP-seq
MIRT1294501	hsa-miR-520d-3p	CLIP-seq
MIRT1294502	hsa-miR-520e	CLIP-seq
MIRT1294503	hsa-miR-526b	CLIP-seq
MIRT1294504	hsa-miR-545	CLIP-seq
MIRT1294505	hsa-miR-548p	CLIP-seq
MIRT1294506	hsa-miR-552	CLIP-seq
MIRT1294507	hsa-miR-561	CLIP-seq
MIRT1294508	hsa-miR-576-3p	CLIP-seq
MIRT1294509	hsa-miR-580	CLIP-seq
MIRT1294510	hsa-miR-582-5p	CLIP-seq
MIRT1294511	hsa-miR-596	CLIP-seq
MIRT1294512	hsa-miR-767-5p	CLIP-seq
MIRT1294513	hsa-miR-92a	CLIP-seq
MIRT1294514	hsa-miR-92b	CLIP-seq
MIRT1294515	hsa-miR-93	CLIP-seq
MIRT1294516	hsa-miR-939	CLIP-seq
MIRT1294451	hsa-miR-1324	CLIP-seq
MIRT1294460	hsa-miR-25	CLIP-seq
MIRT1294473	hsa-miR-32	CLIP-seq
MIRT1294476	hsa-miR-363	CLIP-seq
MIRT1294477	hsa-miR-367	CLIP-seq
MIRT2087544	hsa-miR-4436b-5p	CLIP-seq
MIRT2087545	hsa-miR-4645-3p	CLIP-seq
MIRT1294493	hsa-miR-4698	CLIP-seq
MIRT2087546	hsa-miR-4789-5p	CLIP-seq
MIRT1294504	hsa-miR-545	CLIP-seq
MIRT1294506	hsa-miR-552	CLIP-seq
MIRT1294513	hsa-miR-92a	CLIP-seq
MIRT1294514	hsa-miR-92b	CLIP-seq
MIRT1294445	hsa-miR-106a	CLIP-seq
MIRT1294446	hsa-miR-106b	CLIP-seq
MIRT2312374	hsa-miR-1202	CLIP-seq
MIRT2312375	hsa-miR-1267	CLIP-seq
MIRT2312376	hsa-miR-129-5p	CLIP-seq
MIRT1294451	hsa-miR-1324	CLIP-seq
MIRT1294454	hsa-miR-17	CLIP-seq
MIRT1294455	hsa-miR-20a	CLIP-seq
MIRT1294456	hsa-miR-20b	CLIP-seq
MIRT1294460	hsa-miR-25	CLIP-seq
MIRT2312377	hsa-miR-298	CLIP-seq
MIRT1294467	hsa-miR-3120-3p	CLIP-seq
MIRT2312378	hsa-miR-3182	CLIP-seq
MIRT2312379	hsa-miR-3198	CLIP-seq
MIRT1294473	hsa-miR-32	CLIP-seq
MIRT2312380	hsa-miR-3609	CLIP-seq
MIRT1294476	hsa-miR-363	CLIP-seq
MIRT1294477	hsa-miR-367	CLIP-seq
MIRT2312381	hsa-miR-3678-3p	CLIP-seq
MIRT1294481	hsa-miR-377	CLIP-seq
MIRT2312382	hsa-miR-3942-5p	CLIP-seq
MIRT2312383	hsa-miR-3972	CLIP-seq
MIRT2312384	hsa-miR-4277	CLIP-seq
MIRT2312385	hsa-miR-4309	CLIP-seq
MIRT2087544	hsa-miR-4436b-5p	CLIP-seq
MIRT2312386	hsa-miR-450b-5p	CLIP-seq
MIRT2312387	hsa-miR-4517	CLIP-seq
MIRT2312388	hsa-miR-4652-3p	CLIP-seq
MIRT2312389	hsa-miR-4659a-3p	CLIP-seq
MIRT2312390	hsa-miR-4659b-3p	CLIP-seq
MIRT2312391	hsa-miR-4703-5p	CLIP-seq
MIRT1294494	hsa-miR-4719	CLIP-seq
MIRT2312392	hsa-miR-4735-5p	CLIP-seq
MIRT2312393	hsa-miR-4755-3p	CLIP-seq
MIRT2312394	hsa-miR-4768-5p	CLIP-seq
MIRT2312395	hsa-miR-4776-3p	CLIP-seq
MIRT2087546	hsa-miR-4789-5p	CLIP-seq
MIRT2312396	hsa-miR-4796-3p	CLIP-seq
MIRT2312397	hsa-miR-507	CLIP-seq
MIRT2312398	hsa-miR-5096	CLIP-seq
MIRT2312399	hsa-miR-515-3p	CLIP-seq
MIRT1294497	hsa-miR-519d	CLIP-seq
MIRT2312400	hsa-miR-519e	CLIP-seq
MIRT2312401	hsa-miR-520d-5p	CLIP-seq
MIRT2312402	hsa-miR-524-5p	CLIP-seq
MIRT1294504	hsa-miR-545	CLIP-seq
MIRT2312403	hsa-miR-548ah	CLIP-seq
MIRT1294505	hsa-miR-548p	CLIP-seq
MIRT1294506	hsa-miR-552	CLIP-seq
MIRT2312404	hsa-miR-557	CLIP-seq
MIRT2312405	hsa-miR-576-5p	CLIP-seq
MIRT2312406	hsa-miR-586	CLIP-seq
MIRT2312407	hsa-miR-598	CLIP-seq
MIRT2312408	hsa-miR-873	CLIP-seq
MIRT1294513	hsa-miR-92a	CLIP-seq
MIRT1294514	hsa-miR-92b	CLIP-seq
MIRT1294515	hsa-miR-93	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
CTCF	Unknown	21325284
EGR1	Activation	22431919
NAB2	Activation	22431919
TWIST1	Repression	19051271
TWIST2	Repression	19051271

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA	21873635
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	21873635
GO:0001102	Function	RNA polymerase II activating transcription factor binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	1331501, 9464541, 10869426, 15467457, 16286473, 17531812, 17620057, 19725879, 20133863, 22002537, 27107012, 32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA	21873635
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS
GO:0010629	Process	Negative regulation of gene expression	IMP	25100735
GO:0030154	Process	Cell differentiation	IBA	21873635
GO:0043550	Process	Regulation of lipid kinase activity	IDA	16286473
GO:0051302	Process	Regulation of cell division	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1990841	Function	Promoter-specific chromatin binding	IDA	25100735
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IBA	21873635

MIM	HGNC	e!Ensembl
180203	9894	ENSG00000103479

Protein

UniProt ID

Q08999

Protein name

Retinoblastoma-like protein 2 (130 kDa retinoblastoma-associated protein) (p130) (Retinoblastoma-related protein 2) (RBR-2) (pRb2)

Protein function

Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and target

PDB

4XI9 , 5C1D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11934	DUF3452	104 → 239	Domain of unknown function (DUF3452)	Family
PF01858	RB_A	417 → 609	Retinoblastoma-associated protein A domain	Domain
PF01857	RB_B	835 → 1018	Retinoblastoma-associated protein B domain	Domain

Sequence

MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFDELCSRLNMDE
AARAEAWDSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILKC
SEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEE
QPRQQRGRKQRRQPCTVSEIFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNA
LQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCIIEKLCSLHDGLVLEAKGIKEHFWKP
YIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGEDAEE
EIGTLSRCLNAGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYIKENSPCVTPVS
TATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDF
SNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVV
TFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWK
PESPLWEKIRDNENRVPTCEEVMPPQNLERADEICIAGSPLTPRRVTEVRADTGGLGRSI
TSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPPQPLVNAVPVQNVSGETVSVT
PVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPL
SAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKQGQSVTSSSNRPRKTSSLSLFF
RKVYHLAAVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMA
KVTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDR
TSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDMEEEERGDLIQFYNNIYIKQIKTF
AMKYSQANMDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFSNS
PSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGSH

Sequence length

1139

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Cell cycle PI3K-Akt signaling pathway Cellular senescence Human papillomavirus infection Viral carcinogenesis		Transcription of E2F targets under negative control by DREAM complex G0 and Early G1 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest Cyclin E associated events during G1/S transition G1/S-Specific Transcription Cyclin D associated events in G1 Cyclin A:Cdk2-associated events at S phase entry

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Ovarian cancer	Malignant neoplasm of ovary	rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828 View all (31 more)	16936753

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Neurodevelopmental Disorders	complex neurodevelopmental disorder	GenCC
Diabetes	Diabetes	GWAS
Insomnia	Insomnia	GWAS

Show/Hide Text Mining Associations (51)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Inhibit	11506494
Breast Neoplasms	Associate	15923424, 16760287, 26271034
Burkitt Lymphoma	Associate	10702389, 17485552, 19694314
Carcinogenesis	Associate	10702389, 23725122, 37725511
Carcinogenesis	Inhibit	34851822
Carcinoma Hepatocellular	Associate	26576645, 28639733
Carcinoma Non Small Cell Lung	Associate	35058503
Carcinoma Pancreatic Ductal	Associate	28987387
Carcinoma Renal Cell	Associate	34793840
Carcinoma Squamous Cell	Associate	11710944, 16158962
Carotid Body Tumor	Associate	30967136
Congenital Abnormalities	Associate	32105419
Conversion Disorder	Associate	36129061
Death	Associate	32105419
Developmental Disabilities	Associate	32105419
Endometrial Neoplasms	Inhibit	11506494
Endometrial Neoplasms	Associate	16357517
Ependymoma	Associate	31432742
Esophageal Neoplasms	Associate	31830929
Glioma	Associate	29762838
Hereditary Breast and Ovarian Cancer Syndrome	Associate	16760287
Hypoxia	Associate	36897975
Inflammation	Associate	23108140
Inflammation	Inhibit	33786633
Intellectual Disability	Associate	32105419
Leiomyosarcoma	Associate	29321523
Leukemia Lymphocytic Chronic B Cell	Associate	16038780, 18694959
Lung Neoplasms	Associate	12032225, 15976342, 18793406, 19694314, 21325284
Lymphoma Non Hodgkin	Associate	16158962
Malformations of Cortical Development Group I	Inhibit	36129061
Medulloblastoma	Associate	11577176
Melanoma	Associate	10727462
Mitochondrial Diseases	Associate	36129061, 36897975
Nasopharyngeal Carcinoma	Associate	12032225, 17694957, 19694314
Neoplasms	Associate	10702389, 17485552, 19252413, 21325284, 23725122, 26728921, 27124644, 34487971, 34793840, 34851822, 35716663
Neoplasms	Inhibit	15976342, 16357517, 17106239, 18793406, 22957647, 23572574, 26271034, 27121059, 27567532, 28987387, 29925966, 33934450, 34397405, 35058503
Neuroblastoma	Associate	11736646, 33934450
Obesity	Associate	23591406
Ovarian Neoplasms	Associate	12915404
Pancreatic Neoplasms	Associate	28987387
Precancerous Conditions	Associate	16158962
Prostatic Neoplasms	Associate	18418057, 37352376
Radiation Injuries	Stimulate	35058503
Reperfusion Injury	Associate	36129061
Retinoblastoma	Associate	16955460, 19252413, 24166507, 27124644, 8643454
Retinoblastoma	Inhibit	34851822
Small Cell Lung Carcinoma	Inhibit	9192669
Uterine Cervical Dysplasia	Associate	16158962
Uterine Cervical Neoplasms	Associate	26728921
Uterine Diseases	Inhibit	11506494
Ventricular Remodeling	Associate	36129061

RBL2 (RB transcriptional corepressor like 2)