Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5934
Gene name	RB transcriptional corepressor like 2
Gene symbol	RBL2
Synonyms (NCBI Gene)	BRUWAGP130Rb2
Chromosome	16
Chromosome location	16q12.2

169

Show/Hide all (169)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003218	kshv-miR-K12-4-5p	Luciferase reporter assayWestern blot	20071580
MIRT004139	hsa-miR-192-5p	Microarray	16822819
MIRT005852	hsa-miR-17-5p	Luciferase reporter assay	21283765
MIRT005859	hsa-miR-20a-5p	Luciferase reporter assay	21283765
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	21283765
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	23377830
MIRT019207	hsa-miR-335-5p	Microarray	18185580
MIRT005867	hsa-miR-106b-5p	Microarray	17242205
MIRT005859	hsa-miR-20a-5p	CLASH	23622248
MIRT005852	hsa-miR-17-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23250421
MIRT005852	hsa-miR-17-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23250421
MIRT005852	hsa-miR-17-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23250421
MIRT005852	hsa-miR-17-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23250421
MIRT143571	hsa-miR-106a-5p	Luciferase reporter assay	24045973
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT143571	hsa-miR-106a-5p	Luciferase reporter assay	24045973
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005867	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT143569	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT143605	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT143567	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT1294444	hsa-miR-101	CLIP-seq
MIRT1294445	hsa-miR-106a	CLIP-seq
MIRT1294446	hsa-miR-106b	CLIP-seq
MIRT1294447	hsa-miR-1229	CLIP-seq
MIRT1294448	hsa-miR-1253	CLIP-seq
MIRT1294449	hsa-miR-1254	CLIP-seq
MIRT1294450	hsa-miR-1292	CLIP-seq
MIRT1294451	hsa-miR-1324	CLIP-seq
MIRT1294452	hsa-miR-142-5p	CLIP-seq
MIRT1294453	hsa-miR-144	CLIP-seq
MIRT1294454	hsa-miR-17	CLIP-seq
MIRT1294455	hsa-miR-20a	CLIP-seq
MIRT1294456	hsa-miR-20b	CLIP-seq
MIRT1294457	hsa-miR-23a	CLIP-seq
MIRT1294458	hsa-miR-23b	CLIP-seq
MIRT1294459	hsa-miR-23c	CLIP-seq
MIRT1294460	hsa-miR-25	CLIP-seq
MIRT1294461	hsa-miR-302a	CLIP-seq
MIRT1294462	hsa-miR-302b	CLIP-seq
MIRT1294463	hsa-miR-302c	CLIP-seq
MIRT1294464	hsa-miR-302d	CLIP-seq
MIRT1294465	hsa-miR-302e	CLIP-seq
MIRT1294466	hsa-miR-3116	CLIP-seq
MIRT1294467	hsa-miR-3120-3p	CLIP-seq
MIRT1294468	hsa-miR-3130-3p	CLIP-seq
MIRT1294469	hsa-miR-3148	CLIP-seq
MIRT1294470	hsa-miR-3150a-3p	CLIP-seq
MIRT1294471	hsa-miR-3163	CLIP-seq
MIRT1294472	hsa-miR-3175	CLIP-seq
MIRT1294473	hsa-miR-32	CLIP-seq
MIRT1294474	hsa-miR-3202	CLIP-seq
MIRT1294475	hsa-miR-340	CLIP-seq
MIRT1294476	hsa-miR-363	CLIP-seq
MIRT1294477	hsa-miR-367	CLIP-seq
MIRT1294478	hsa-miR-3674	CLIP-seq
MIRT1294479	hsa-miR-372	CLIP-seq
MIRT1294480	hsa-miR-373	CLIP-seq
MIRT1294481	hsa-miR-377	CLIP-seq
MIRT1294482	hsa-miR-4272	CLIP-seq
MIRT1294483	hsa-miR-4274	CLIP-seq
MIRT1294484	hsa-miR-4282	CLIP-seq
MIRT1294485	hsa-miR-4293	CLIP-seq
MIRT1294486	hsa-miR-4420	CLIP-seq
MIRT1294487	hsa-miR-4424	CLIP-seq
MIRT1294488	hsa-miR-4519	CLIP-seq
MIRT1294489	hsa-miR-4533	CLIP-seq
MIRT1294490	hsa-miR-4653-3p	CLIP-seq
MIRT1294491	hsa-miR-4668-3p	CLIP-seq
MIRT1294492	hsa-miR-4668-5p	CLIP-seq
MIRT1294493	hsa-miR-4698	CLIP-seq
MIRT1294494	hsa-miR-4719	CLIP-seq
MIRT1294495	hsa-miR-4764-5p	CLIP-seq
MIRT1294496	hsa-miR-4790-3p	CLIP-seq
MIRT1294497	hsa-miR-519d	CLIP-seq
MIRT1294498	hsa-miR-520a-3p	CLIP-seq
MIRT1294499	hsa-miR-520b	CLIP-seq
MIRT1294500	hsa-miR-520c-3p	CLIP-seq
MIRT1294501	hsa-miR-520d-3p	CLIP-seq
MIRT1294502	hsa-miR-520e	CLIP-seq
MIRT1294503	hsa-miR-526b	CLIP-seq
MIRT1294504	hsa-miR-545	CLIP-seq
MIRT1294505	hsa-miR-548p	CLIP-seq
MIRT1294506	hsa-miR-552	CLIP-seq
MIRT1294507	hsa-miR-561	CLIP-seq
MIRT1294508	hsa-miR-576-3p	CLIP-seq
MIRT1294509	hsa-miR-580	CLIP-seq
MIRT1294510	hsa-miR-582-5p	CLIP-seq
MIRT1294511	hsa-miR-596	CLIP-seq
MIRT1294512	hsa-miR-767-5p	CLIP-seq
MIRT1294513	hsa-miR-92a	CLIP-seq
MIRT1294514	hsa-miR-92b	CLIP-seq
MIRT1294515	hsa-miR-93	CLIP-seq
MIRT1294516	hsa-miR-939	CLIP-seq
MIRT1294451	hsa-miR-1324	CLIP-seq
MIRT1294460	hsa-miR-25	CLIP-seq
MIRT1294473	hsa-miR-32	CLIP-seq
MIRT1294476	hsa-miR-363	CLIP-seq
MIRT1294477	hsa-miR-367	CLIP-seq
MIRT2087544	hsa-miR-4436b-5p	CLIP-seq
MIRT2087545	hsa-miR-4645-3p	CLIP-seq
MIRT1294493	hsa-miR-4698	CLIP-seq
MIRT2087546	hsa-miR-4789-5p	CLIP-seq
MIRT1294504	hsa-miR-545	CLIP-seq
MIRT1294506	hsa-miR-552	CLIP-seq
MIRT1294513	hsa-miR-92a	CLIP-seq
MIRT1294514	hsa-miR-92b	CLIP-seq
MIRT1294445	hsa-miR-106a	CLIP-seq
MIRT1294446	hsa-miR-106b	CLIP-seq
MIRT2312374	hsa-miR-1202	CLIP-seq
MIRT2312375	hsa-miR-1267	CLIP-seq
MIRT2312376	hsa-miR-129-5p	CLIP-seq
MIRT1294451	hsa-miR-1324	CLIP-seq
MIRT1294454	hsa-miR-17	CLIP-seq
MIRT1294455	hsa-miR-20a	CLIP-seq
MIRT1294456	hsa-miR-20b	CLIP-seq
MIRT1294460	hsa-miR-25	CLIP-seq
MIRT2312377	hsa-miR-298	CLIP-seq
MIRT1294467	hsa-miR-3120-3p	CLIP-seq
MIRT2312378	hsa-miR-3182	CLIP-seq
MIRT2312379	hsa-miR-3198	CLIP-seq
MIRT1294473	hsa-miR-32	CLIP-seq
MIRT2312380	hsa-miR-3609	CLIP-seq
MIRT1294476	hsa-miR-363	CLIP-seq
MIRT1294477	hsa-miR-367	CLIP-seq
MIRT2312381	hsa-miR-3678-3p	CLIP-seq
MIRT1294481	hsa-miR-377	CLIP-seq
MIRT2312382	hsa-miR-3942-5p	CLIP-seq
MIRT2312383	hsa-miR-3972	CLIP-seq
MIRT2312384	hsa-miR-4277	CLIP-seq
MIRT2312385	hsa-miR-4309	CLIP-seq
MIRT2087544	hsa-miR-4436b-5p	CLIP-seq
MIRT2312386	hsa-miR-450b-5p	CLIP-seq
MIRT2312387	hsa-miR-4517	CLIP-seq
MIRT2312388	hsa-miR-4652-3p	CLIP-seq
MIRT2312389	hsa-miR-4659a-3p	CLIP-seq
MIRT2312390	hsa-miR-4659b-3p	CLIP-seq
MIRT2312391	hsa-miR-4703-5p	CLIP-seq
MIRT1294494	hsa-miR-4719	CLIP-seq
MIRT2312392	hsa-miR-4735-5p	CLIP-seq
MIRT2312393	hsa-miR-4755-3p	CLIP-seq
MIRT2312394	hsa-miR-4768-5p	CLIP-seq
MIRT2312395	hsa-miR-4776-3p	CLIP-seq
MIRT2087546	hsa-miR-4789-5p	CLIP-seq
MIRT2312396	hsa-miR-4796-3p	CLIP-seq
MIRT2312397	hsa-miR-507	CLIP-seq
MIRT2312398	hsa-miR-5096	CLIP-seq
MIRT2312399	hsa-miR-515-3p	CLIP-seq
MIRT1294497	hsa-miR-519d	CLIP-seq
MIRT2312400	hsa-miR-519e	CLIP-seq
MIRT2312401	hsa-miR-520d-5p	CLIP-seq
MIRT2312402	hsa-miR-524-5p	CLIP-seq
MIRT1294504	hsa-miR-545	CLIP-seq
MIRT2312403	hsa-miR-548ah	CLIP-seq
MIRT1294505	hsa-miR-548p	CLIP-seq
MIRT1294506	hsa-miR-552	CLIP-seq
MIRT2312404	hsa-miR-557	CLIP-seq
MIRT2312405	hsa-miR-576-5p	CLIP-seq
MIRT2312406	hsa-miR-586	CLIP-seq
MIRT2312407	hsa-miR-598	CLIP-seq
MIRT2312408	hsa-miR-873	CLIP-seq
MIRT1294513	hsa-miR-92a	CLIP-seq
MIRT1294514	hsa-miR-92b	CLIP-seq
MIRT1294515	hsa-miR-93	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
CTCF	Unknown	21325284
EGR1	Activation	22431919
NAB2	Activation	22431919
TWIST1	Repression	19051271
TWIST2	Repression	19051271

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	1331501, 9464541, 10869426, 15467457, 16286473, 17531812, 17620057, 19725879, 20133863, 22002537, 22094256, 27107012, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	25100735
GO:0030154	Process	Cell differentiation	IBA
GO:0043550	Process	Regulation of lipid kinase activity	IDA	16286473
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1990841	Function	Promoter-specific chromatin binding	IDA	25100735
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IBA

MIM	HGNC	e!Ensembl
180203	9894	ENSG00000103479

Q08999

Protein name

Retinoblastoma-like protein 2 (130 kDa retinoblastoma-associated protein) (p130) (Retinoblastoma-related protein 2) (RBR-2) (pRb2)

Protein function

Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and target

PDB

4XI9 , 5C1D

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11934	DUF3452	104 → 239	Domain of unknown function (DUF3452)	Family
PF01858	RB_A	417 → 609	Retinoblastoma-associated protein A domain	Domain
PF01857	RB_B	835 → 1018	Retinoblastoma-associated protein B domain	Domain

Sequence

MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFDELCSRLNMDE
AARAEAWDSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTVEGNYVSLTRILKC
SEQSLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEE
QPRQQRGRKQRRQPCTVSEIFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNA
LQCSNRKELVNPNFKGLSEDFHAKDSKPSSDPPCIIEKLCSLHDGLVLEAKGIKEHFWKP
YIRKLYEKKLLKGKEENLTGFLEPGNFGESFKAINKAYEEYVLSVGNLDERIFLGEDAEE
EIGTLSRCLNAGSGTETAERVQMKNILQQHFDKSKALRISTPLTGVRYIKENSPCVTPVS
TATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDF
SNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVV
TFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWK
PESPLWEKIRDNENRVPTCEEVMPPQNLERADEICIAGSPLTPRRVTEVRADTGGLGRSI
TSPTTLYDRYSSPPASTTRRRLFVENDSPSDGGTPGRMPPQPLVNAVPVQNVSGETVSVT
PVPGQTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPL
SAQALAGSLSSQQVTGTTLQVPGQVAIQQISPGGQQQKQGQSVTSSSNRPRKTSSLSLFF
RKVYHLAAVRLRDLCAKLDISDELRKKIWTCFEFSIIQCPELMMDRHLDQLLMCAIYVMA
KVTKEDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRKRRNSGSSDSRSHQNSPTELNKDR
TSRDSSPVMRSSSTLPVPQPSSAPPTPTRLTGANSDMEEEERGDLIQFYNNIYIKQIKTF
AMKYSQANMDAPPLSPYPFVRTGSPRRIQLSQNHPVYISPHKNETMLSPREKIFYYFSNS
PSKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQDVANDRGSH

Sequence length

1139

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Cell cycle PI3K-Akt signaling pathway Cellular senescence Human papillomavirus infection Viral carcinogenesis		Transcription of E2F targets under negative control by DREAM complex G0 and Early G1 TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest Cyclin E associated events during G1/S transition G1/S-Specific Transcription Cyclin D associated events in G1 Cyclin A:Cdk2-associated events at S phase entry

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Brunet-Wagner neurodevelopmental syndrome	Likely pathogenic; Pathogenic	rs2153138545, rs1401758241, rs757065708, rs2150795233, rs2058068934, rs2506702087	RCV001807545 RCV001807547 RCV001808866 RCV001824098 RCV003484516 RCV003990363	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RBL2-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (51)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Inhibit	11506494	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	15923424, 16760287, 26271034	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Associate	10702389, 17485552, 19694314	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	10702389, 23725122, 37725511	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Inhibit	34851822	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	26576645, 28639733	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	35058503	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	28987387	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	34793840	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	11710944, 16158962	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Body Tumor	Associate	30967136	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Associate	32105419	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conversion Disorder	Associate	36129061	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death	Associate	32105419	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Associate	32105419	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Inhibit	11506494	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	16357517	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Associate	31432742	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	31830929	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	29762838	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	16760287	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	36897975	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	23108140	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	33786633	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Associate	32105419	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Associate	29321523	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	16038780, 18694959	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	12032225, 15976342, 18793406, 19694314, 21325284	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	16158962	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development Group I	Inhibit	36129061	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Associate	11577176	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	10727462	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Associate	36129061, 36897975	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	12032225, 17694957, 19694314	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	10702389, 17485552, 19252413, 21325284, 23725122, 26728921, 27124644, 34487971, 34793840, 34851822, 35716663	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	15976342, 16357517, 17106239, 18793406, 22957647, 23572574, 26271034, 27121059, 27567532, 28987387, 29925966, 33934450, 34397405, 35058503	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	11736646, 33934450	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	23591406	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	12915404	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Associate	28987387	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precancerous Conditions	Associate	16158962	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	18418057, 37352376	★★★★★ ★☆☆☆☆ Found in Text Mining only
Radiation Injuries	Stimulate	35058503	★★★★★ ★☆☆☆☆ Found in Text Mining only
Reperfusion Injury	Associate	36129061	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Associate	16955460, 19252413, 24166507, 27124644, 8643454	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Inhibit	34851822	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Inhibit	9192669	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Associate	16158962	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	26728921	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Inhibit	11506494	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Associate	36129061	★★★★★ ★☆☆☆☆ Found in Text Mining only

RBL2 (RB transcriptional corepressor like 2)