Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5932
Gene name Gene Name - the full gene name approved by the HGNC.
RB binding protein 8, endonuclease
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RBBP8
Synonyms (NCBI Gene) Gene synonyms aliases
COM1, CTIP, JAWAD, JWDS, RIM, SAE2, SCKL2
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a ubiquitously expressed nuclear protein. It is found among several proteins that bind directly to retinoblastoma protein, which regulates cell proliferation. This protein complexes with transcriptional co-repressor CTB
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121434388 A>G Uncertain-significance, pathogenic Missense variant, coding sequence variant
rs373804633 C>G,T Pathogenic Missense variant, coding sequence variant, 5 prime UTR variant
rs587776883 T>G Pathogenic Intron variant
rs587776884 TA>- Pathogenic Coding sequence variant, frameshift variant
rs587780432 G>T Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019821 hsa-miR-375 Microarray 20215506
MIRT469541 hsa-miR-3174 PAR-CLIP 23592263
MIRT469540 hsa-miR-1247-3p PAR-CLIP 23592263
MIRT469539 hsa-miR-5186 PAR-CLIP 23592263
MIRT469538 hsa-miR-6087 PAR-CLIP 23592263
Transcription factors
Transcription factor Regulation Reference
YBX1 Repression 20596676
ZNF350 Unknown 20713352
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000014 Function Single-stranded DNA endodeoxyribonuclease activity IMP 18716619, 19202191, 31802118
GO:0000082 Process G1/S transition of mitotic cell cycle IEA
GO:0000724 Process Double-strand break repair via homologous recombination IDA 27814491, 27889449, 30787182, 31802118
GO:0000724 Process Double-strand break repair via homologous recombination IMP 26721387
GO:0001835 Process Blastocyst hatching IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604124 9891 ENSG00000101773
Protein
UniProt ID Q99708
Protein name DNA endonuclease RBBP8 (EC 3.1.-.-) (CtBP-interacting protein) (CtIP) (Retinoblastoma-binding protein 8) (RBBP-8) (Retinoblastoma-interacting protein and myosin-like) (RIM) (Sporulation in the absence of SPO11 protein 2 homolog) (SAE2)
Protein function Endonuclease that cooperates with the MRE11-RAD50-NBN (MRN) complex in DNA-end resection, the first step of double-strand break (DSB) repair through the homologous recombination (HR) pathway (PubMed:17965729, PubMed:19202191, PubMed:19759395, Pu
PDB 1Y98 , 2L4Z , 4D2H , 7BGF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10482 CtIP_N 20 139 Tumour-suppressor protein CtIP N-terminal domain Coiled-coil
PF08573 SAE2 822 858 DNA repair protein endonuclease SAE2/CtIP C-terminus Family
Tissue specificity TISSUE SPECIFICITY: Expressed in ER-positive breast cancer lines, but tends to be down-regulated ER-negative cells (at protein level). {ECO:0000269|PubMed:18171986}.
Sequence
MNISGSSCGSPNSADTSSDFKDLWTKLKECHDREVQGLQVKVTKLKQERILDAQRLEEFF
TKNQQLREQQKVLHETIKVLEDRLRAGLCDRCAVTEEHMRKKQQEFENIRQQNLKLITEL
MNERNTLQEENKKLSEQLQ
QKIENDQQHQAAELECEEDVIPDSPITAFSFSGVNRLRRKE
NPHVRYIEQTHTKLEHSVCANEMRKVSKSSTHPQHNPNENEILVADTYDQSQSPMAKAHG
TSSYTPDKSSFNLATVVAETLGLGVQEESETQGPMSPLGDELYHCLEGNHKKQPFEESTR
NTEDSLRFSDSTSKTPPQEELPTRVSSPVFGATSSIKSGLDLNTSLSPSLLQPGKKKHLK
TLPFSNTCISRLEKTRSKSEDSALFTHHSLGSEVNKIIIQSSNKQILINKNISESLGEQN
RTEYGKDSNTDKHLEPLKSLGGRTSKRKKTEEESEHEVSCPQASFDKENAFPFPMDNQFS
MNGDCVMDKPLDLSDRFSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASD
GNCTLPKDSPGEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETENVL
DDIKSAGSHEPIKIQTRSDHGGCELASVLQLNPCRTGKIKSLQNNQDVSFENIQWSIDPG
ADLSQYKMDVTVIDTKDGSQSKLGGETVDMDCTLVSETVLLKMKKQEQKGEKSSNEERKM
NDSLEDMFDRTTHEEYESCLADSFSQAADEEEELSTATKKLHTHGDKQDKVKQKAFVEPY
FKGDERETSLQNFPHIEVVRKKEERRKLLGHTCKECEIYYADMPAEEREKKLASCSRHRF
RYIPPNTPENFWEVGFPS
TQTCMERGYIKEDLDPCPRPKRRQPYNAIFSPKGKEQKT
Sequence length 897
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Homologous recombination   HDR through Single Strand Annealing (SSA)
HDR through MMEJ (alt-NHEJ)
HDR through Homologous Recombination (HRR)
Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
Resolution of D-loop Structures through Holliday Junction Intermediates
Homologous DNA Pairing and Strand Exchange
Processing of DNA double-strand break ends
Presynaptic phase of homologous DNA pairing and strand exchange
Regulation of TP53 Activity through Phosphorylation
G2/M DNA damage checkpoint
Transcriptional Regulation by E2F6
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Jawad Syndrome jawad syndrome rs587776884 N/A
Seckel Syndrome seckel syndrome 2 rs587776883, rs762396810 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Nonatopic asthma N/A N/A GWAS
Breast cancer Breast cancer, Invasive breast cancer N/A N/A GWAS
Microcephaly microcephaly N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Aortic Aneurysm Familial Abdominal 1 Associate 27418160
Ataxia Telangiectasia Associate 22544744
Ataxia Telangiectasia Like Disorder Associate 23080121
ATR X syndrome Stimulate 31628488
Breast Neoplasms Associate 18171986, 21799032, 23468639, 24403251, 32379725, 34718410
Carcinogenesis Associate 30622325, 9535825
Carcinoma Non Small Cell Lung Associate 23407556, 35100078
Chromosome Aberrations Associate 23349304
Colorectal Neoplasms Associate 12414815, 23770684
DNA Virus Infections Associate 29445424