Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5931
Gene name	RB binding protein 7, chromatin remodeling factor
Gene symbol	RBBP7
Synonyms (NCBI Gene)	RbAp46SPGFX9
Chromosome	X
Chromosome location	Xp22.2
Summary	This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded p

223

Show/Hide all (223)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016133	hsa-miR-421	Sequencing	20371350
MIRT028061	hsa-miR-93-5p	Sequencing	20371350
MIRT049160	hsa-miR-92a-3p	CLASH	23622248
MIRT046129	hsa-miR-30b-5p	CLASH	23622248
MIRT044126	hsa-miR-30e-3p	CLASH	23622248
MIRT546803	hsa-miR-4778-5p	PAR-CLIP	21572407
MIRT546802	hsa-miR-4742-3p	PAR-CLIP	21572407
MIRT546801	hsa-miR-3924	PAR-CLIP	21572407
MIRT546800	hsa-miR-3686	PAR-CLIP	21572407
MIRT439810	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439809	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439810	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726781	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT726780	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT028061	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726779	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439809	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT546803	hsa-miR-4778-5p	PAR-CLIP	21572407
MIRT546802	hsa-miR-4742-3p	PAR-CLIP	21572407
MIRT546801	hsa-miR-3924	PAR-CLIP	21572407
MIRT546800	hsa-miR-3686	PAR-CLIP	21572407
MIRT1293929	hsa-miR-101	CLIP-seq
MIRT1293930	hsa-miR-106a	CLIP-seq
MIRT1293931	hsa-miR-106b	CLIP-seq
MIRT1293932	hsa-miR-1179	CLIP-seq
MIRT1293933	hsa-miR-1185	CLIP-seq
MIRT1293934	hsa-miR-1284	CLIP-seq
MIRT1293935	hsa-miR-144	CLIP-seq
MIRT1293936	hsa-miR-17	CLIP-seq
MIRT1293937	hsa-miR-186	CLIP-seq
MIRT1293938	hsa-miR-20a	CLIP-seq
MIRT1293939	hsa-miR-20b	CLIP-seq
MIRT1293940	hsa-miR-300	CLIP-seq
MIRT1293941	hsa-miR-302a	CLIP-seq
MIRT1293942	hsa-miR-302b	CLIP-seq
MIRT1293943	hsa-miR-302c	CLIP-seq
MIRT1293944	hsa-miR-302d	CLIP-seq
MIRT1293945	hsa-miR-302e	CLIP-seq
MIRT1293946	hsa-miR-3133	CLIP-seq
MIRT1293947	hsa-miR-3161	CLIP-seq
MIRT1293948	hsa-miR-338-5p	CLIP-seq
MIRT1293949	hsa-miR-3614-5p	CLIP-seq
MIRT1293950	hsa-miR-3679-5p	CLIP-seq
MIRT1293951	hsa-miR-3685	CLIP-seq
MIRT1293952	hsa-miR-372	CLIP-seq
MIRT1293953	hsa-miR-373	CLIP-seq
MIRT1293954	hsa-miR-381	CLIP-seq
MIRT1293955	hsa-miR-384	CLIP-seq
MIRT1293956	hsa-miR-4257	CLIP-seq
MIRT1293957	hsa-miR-4286	CLIP-seq
MIRT1293958	hsa-miR-4517	CLIP-seq
MIRT1293959	hsa-miR-4666-3p	CLIP-seq
MIRT1293960	hsa-miR-4786-3p	CLIP-seq
MIRT1293961	hsa-miR-488	CLIP-seq
MIRT1293962	hsa-miR-519d	CLIP-seq
MIRT1293963	hsa-miR-520a-3p	CLIP-seq
MIRT1293964	hsa-miR-520b	CLIP-seq
MIRT1293965	hsa-miR-520c-3p	CLIP-seq
MIRT1293966	hsa-miR-520d-3p	CLIP-seq
MIRT1293967	hsa-miR-520e	CLIP-seq
MIRT1293968	hsa-miR-532-5p	CLIP-seq
MIRT1293969	hsa-miR-93	CLIP-seq
MIRT1293929	hsa-miR-101	CLIP-seq
MIRT1293930	hsa-miR-106a	CLIP-seq
MIRT1293931	hsa-miR-106b	CLIP-seq
MIRT1293932	hsa-miR-1179	CLIP-seq
MIRT1293933	hsa-miR-1185	CLIP-seq
MIRT1293935	hsa-miR-144	CLIP-seq
MIRT1293936	hsa-miR-17	CLIP-seq
MIRT1293970	hsa-miR-181a	CLIP-seq
MIRT1293971	hsa-miR-181b	CLIP-seq
MIRT1293972	hsa-miR-181c	CLIP-seq
MIRT1293973	hsa-miR-181d	CLIP-seq
MIRT1293937	hsa-miR-186	CLIP-seq
MIRT1293938	hsa-miR-20a	CLIP-seq
MIRT1293939	hsa-miR-20b	CLIP-seq
MIRT1293941	hsa-miR-302a	CLIP-seq
MIRT1293942	hsa-miR-302b	CLIP-seq
MIRT1293943	hsa-miR-302c	CLIP-seq
MIRT1293944	hsa-miR-302d	CLIP-seq
MIRT1293945	hsa-miR-302e	CLIP-seq
MIRT1293946	hsa-miR-3133	CLIP-seq
MIRT1293949	hsa-miR-3614-5p	CLIP-seq
MIRT1293950	hsa-miR-3679-5p	CLIP-seq
MIRT1293952	hsa-miR-372	CLIP-seq
MIRT1293953	hsa-miR-373	CLIP-seq
MIRT1293956	hsa-miR-4257	CLIP-seq
MIRT1293974	hsa-miR-4262	CLIP-seq
MIRT1293975	hsa-miR-4272	CLIP-seq
MIRT1293957	hsa-miR-4286	CLIP-seq
MIRT1293976	hsa-miR-4709-5p	CLIP-seq
MIRT1293960	hsa-miR-4786-3p	CLIP-seq
MIRT1293961	hsa-miR-488	CLIP-seq
MIRT1293977	hsa-miR-494	CLIP-seq
MIRT1293962	hsa-miR-519d	CLIP-seq
MIRT1293963	hsa-miR-520a-3p	CLIP-seq
MIRT1293964	hsa-miR-520b	CLIP-seq
MIRT1293965	hsa-miR-520c-3p	CLIP-seq
MIRT1293966	hsa-miR-520d-3p	CLIP-seq
MIRT1293967	hsa-miR-520e	CLIP-seq
MIRT1293969	hsa-miR-93	CLIP-seq
MIRT2087377	hsa-miR-10a	CLIP-seq
MIRT2087378	hsa-miR-10b	CLIP-seq
MIRT1293932	hsa-miR-1179	CLIP-seq
MIRT2087379	hsa-miR-1236	CLIP-seq
MIRT2087380	hsa-miR-1292	CLIP-seq
MIRT2087381	hsa-miR-2116	CLIP-seq
MIRT2087382	hsa-miR-2276	CLIP-seq
MIRT2087383	hsa-miR-3120-3p	CLIP-seq
MIRT2087384	hsa-miR-3122	CLIP-seq
MIRT1293948	hsa-miR-338-5p	CLIP-seq
MIRT2087385	hsa-miR-3913-5p	CLIP-seq
MIRT2087386	hsa-miR-4471	CLIP-seq
MIRT2087387	hsa-miR-448	CLIP-seq
MIRT2087388	hsa-miR-4503	CLIP-seq
MIRT1293958	hsa-miR-4517	CLIP-seq
MIRT2087389	hsa-miR-4659a-3p	CLIP-seq
MIRT2087390	hsa-miR-4659b-3p	CLIP-seq
MIRT2087391	hsa-miR-4677-5p	CLIP-seq
MIRT2087392	hsa-miR-4753-3p	CLIP-seq
MIRT2087393	hsa-miR-4772-3p	CLIP-seq
MIRT2087394	hsa-miR-518a-5p	CLIP-seq
MIRT2087395	hsa-miR-527	CLIP-seq
MIRT2087396	hsa-miR-543	CLIP-seq
MIRT2087397	hsa-miR-544	CLIP-seq
MIRT2087398	hsa-miR-548an	CLIP-seq
MIRT2087399	hsa-miR-643	CLIP-seq
MIRT2087400	hsa-miR-942	CLIP-seq
MIRT1293929	hsa-miR-101	CLIP-seq
MIRT1293930	hsa-miR-106a	CLIP-seq
MIRT1293931	hsa-miR-106b	CLIP-seq
MIRT1293933	hsa-miR-1185	CLIP-seq
MIRT1293935	hsa-miR-144	CLIP-seq
MIRT1293936	hsa-miR-17	CLIP-seq
MIRT1293937	hsa-miR-186	CLIP-seq
MIRT1293938	hsa-miR-20a	CLIP-seq
MIRT1293939	hsa-miR-20b	CLIP-seq
MIRT1293941	hsa-miR-302a	CLIP-seq
MIRT1293942	hsa-miR-302b	CLIP-seq
MIRT1293943	hsa-miR-302c	CLIP-seq
MIRT1293944	hsa-miR-302d	CLIP-seq
MIRT1293945	hsa-miR-302e	CLIP-seq
MIRT1293946	hsa-miR-3133	CLIP-seq
MIRT1293949	hsa-miR-3614-5p	CLIP-seq
MIRT1293950	hsa-miR-3679-5p	CLIP-seq
MIRT1293952	hsa-miR-372	CLIP-seq
MIRT1293953	hsa-miR-373	CLIP-seq
MIRT1293956	hsa-miR-4257	CLIP-seq
MIRT1293961	hsa-miR-488	CLIP-seq
MIRT1293962	hsa-miR-519d	CLIP-seq
MIRT1293963	hsa-miR-520a-3p	CLIP-seq
MIRT1293964	hsa-miR-520b	CLIP-seq
MIRT1293965	hsa-miR-520c-3p	CLIP-seq
MIRT1293966	hsa-miR-520d-3p	CLIP-seq
MIRT1293967	hsa-miR-520e	CLIP-seq
MIRT1293969	hsa-miR-93	CLIP-seq
MIRT1293932	hsa-miR-1179	CLIP-seq
MIRT1293970	hsa-miR-181a	CLIP-seq
MIRT1293971	hsa-miR-181b	CLIP-seq
MIRT1293972	hsa-miR-181c	CLIP-seq
MIRT1293973	hsa-miR-181d	CLIP-seq
MIRT1293974	hsa-miR-4262	CLIP-seq
MIRT1293975	hsa-miR-4272	CLIP-seq
MIRT1293976	hsa-miR-4709-5p	CLIP-seq
MIRT1293929	hsa-miR-101	CLIP-seq
MIRT1293930	hsa-miR-106a	CLIP-seq
MIRT1293931	hsa-miR-106b	CLIP-seq
MIRT1293932	hsa-miR-1179	CLIP-seq
MIRT1293934	hsa-miR-1284	CLIP-seq
MIRT1293935	hsa-miR-144	CLIP-seq
MIRT1293936	hsa-miR-17	CLIP-seq
MIRT1293970	hsa-miR-181a	CLIP-seq
MIRT1293971	hsa-miR-181b	CLIP-seq
MIRT1293972	hsa-miR-181c	CLIP-seq
MIRT1293973	hsa-miR-181d	CLIP-seq
MIRT1293938	hsa-miR-20a	CLIP-seq
MIRT1293939	hsa-miR-20b	CLIP-seq
MIRT1293940	hsa-miR-300	CLIP-seq
MIRT1293941	hsa-miR-302a	CLIP-seq
MIRT1293942	hsa-miR-302b	CLIP-seq
MIRT1293943	hsa-miR-302c	CLIP-seq
MIRT1293944	hsa-miR-302d	CLIP-seq
MIRT1293945	hsa-miR-302e	CLIP-seq
MIRT1293947	hsa-miR-3161	CLIP-seq
MIRT1293949	hsa-miR-3614-5p	CLIP-seq
MIRT1293951	hsa-miR-3685	CLIP-seq
MIRT1293952	hsa-miR-372	CLIP-seq
MIRT1293953	hsa-miR-373	CLIP-seq
MIRT1293954	hsa-miR-381	CLIP-seq
MIRT1293955	hsa-miR-384	CLIP-seq
MIRT1293974	hsa-miR-4262	CLIP-seq
MIRT1293975	hsa-miR-4272	CLIP-seq
MIRT1293959	hsa-miR-4666-3p	CLIP-seq
MIRT1293976	hsa-miR-4709-5p	CLIP-seq
MIRT1293961	hsa-miR-488	CLIP-seq
MIRT1293962	hsa-miR-519d	CLIP-seq
MIRT1293963	hsa-miR-520a-3p	CLIP-seq
MIRT1293964	hsa-miR-520b	CLIP-seq
MIRT1293965	hsa-miR-520c-3p	CLIP-seq
MIRT1293966	hsa-miR-520d-3p	CLIP-seq
MIRT1293967	hsa-miR-520e	CLIP-seq
MIRT1293968	hsa-miR-532-5p	CLIP-seq
MIRT1293969	hsa-miR-93	CLIP-seq
MIRT1293929	hsa-miR-101	CLIP-seq
MIRT1293932	hsa-miR-1179	CLIP-seq
MIRT1293934	hsa-miR-1284	CLIP-seq
MIRT1293935	hsa-miR-144	CLIP-seq
MIRT1293970	hsa-miR-181a	CLIP-seq
MIRT1293971	hsa-miR-181b	CLIP-seq
MIRT1293972	hsa-miR-181c	CLIP-seq
MIRT1293973	hsa-miR-181d	CLIP-seq
MIRT1293940	hsa-miR-300	CLIP-seq
MIRT1293947	hsa-miR-3161	CLIP-seq
MIRT1293949	hsa-miR-3614-5p	CLIP-seq
MIRT1293951	hsa-miR-3685	CLIP-seq
MIRT1293954	hsa-miR-381	CLIP-seq
MIRT1293955	hsa-miR-384	CLIP-seq
MIRT1293974	hsa-miR-4262	CLIP-seq
MIRT1293975	hsa-miR-4272	CLIP-seq
MIRT1293959	hsa-miR-4666-3p	CLIP-seq
MIRT1293976	hsa-miR-4709-5p	CLIP-seq
MIRT1293961	hsa-miR-488	CLIP-seq
MIRT1293968	hsa-miR-532-5p	CLIP-seq

Show/Hide all (47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IDA	9651585
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	NAS	9651585, 22865885
GO:0000781	Component	Chromosome, telomeric region	IDA	25150861
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	7503932, 9150135, 9651585, 18571423, 19497860, 19703393, 19862764, 21258344, 22720776, 23752268, 24981860, 25150861, 26496610, 27705803, 28179136, 28514442, 31980649, 33961781, 35271311
GO:0005634	Component	Nucleus	HDA	16791210
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20523938, 22720776, 28977666, 33283408
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	14609955, 28554894
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006260	Process	DNA replication	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IDA	9790534, 14609955
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	14609955
GO:0007420	Process	Brain development	NAS	14609955
GO:0016581	Component	NuRD complex	IBA
GO:0016581	Component	NuRD complex	IDA	19644445, 22926524, 33283408
GO:0016581	Component	NuRD complex	IEA
GO:0016581	Component	NuRD complex	NAS	16428440
GO:0016589	Component	NURF complex	IEA
GO:0016589	Component	NURF complex	IPI	14609955
GO:0030308	Process	Negative regulation of cell growth	IDA	9765217
GO:0030336	Process	Negative regulation of cell migration	NAS	22984288
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	NAS	22984288
GO:0035098	Component	ESC/E(Z) complex	IBA
GO:0035098	Component	ESC/E(Z) complex	IDA	20075857, 23104054, 23273982
GO:0035098	Component	ESC/E(Z) complex	IEA
GO:0042393	Function	Histone binding	IBA
GO:0042393	Function	Histone binding	IDA	9651585
GO:0042659	Process	Regulation of cell fate specification	NAS	22560079
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	22560079
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	19927129
GO:0048545	Process	Response to steroid hormone	IEA
GO:0070370	Process	Cellular heat acclimation	IDA	7503932
GO:0070822	Component	Sin3-type complex	NAS	28554894
GO:1902455	Process	Negative regulation of stem cell population maintenance	NAS	28554894
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	28554894
GO:1904949	Component	ATPase complex	IDA	14609955
GO:2000736	Process	Regulation of stem cell differentiation	NAS	22560079

MIM	HGNC	e!Ensembl
300825	9890	ENSG00000102054

Q16576

Protein name

Histone-binding protein RBBP7 (Histone acetyltransferase type B subunit 2) (Nucleosome-remodeling factor subunit RBAP46) (Retinoblastoma-binding protein 7) (RBBP-7) (Retinoblastoma-binding protein p46)

Protein function

Core histone-binding subunit that may target chromatin remodeling factors, histone acetyltransferases and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which reg

PDB

3CFS , 3CFV , 7M3X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12265	CAF1C_H4-bd	18 → 87	Histone-binding protein RBBP4 or subunit C of CAF1 complex	Family
PF00400	WD40	166 → 205	WD domain, G-beta repeat	Repeat
PF00400	WD40	217 → 255	WD domain, G-beta repeat	Repeat
PF00400	WD40	262 → 301	WD domain, G-beta repeat	Repeat
PF00400	WD40	307 → 345	WD domain, G-beta repeat	Repeat
PF00400	WD40	363 → 402	WD domain, G-beta repeat	Repeat

Sequence

MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDY
ALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKI
NHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGY
GLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHES
LFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALW
DLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAED
GPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL
EGQGS

Sequence length

425

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling Polycomb repressive complex		PRC2 methylates histones and DNA Oxidative Stress Induced Senescence HDACs deacetylate histones PKMTs methylate histone lysines HATs acetylate histones RMTs methylate histone arginines Deposition of new CENPA-containing nucleosomes at the centromere Regulation of TP53 Activity through Acetylation RNA Polymerase I Transcription Initiation Regulation of PTEN gene transcription Neddylation Transcriptional Regulation by E2F6 HCMV Early Events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPERMATOGENIC FAILURE, X-LINKED, 9	—	ClinVar, GenCC, HPO ClinVar, GenCC, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	36311801, 36503492	★★★★★ ★☆☆☆☆ Found in Text Mining only
AIDS Associated Nephropathy	Associate	35958876	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	36720950	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Associate	35809576	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Associate	20920292	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	30637779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	31957828, 35538026	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	34086947	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	35538026	★★★★★ ★☆☆☆☆ Found in Text Mining only
Male Infertility with Large Headed Multiflagellar Polyploid Spermatozoa	Associate	35809576	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Stimulate	26254420	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Associate	26254420	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nance Horan syndrome	Associate	35122698	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	31911655, 34086947, 35538026, 36503492	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Associate	35809576	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Associate	30120321	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Associate	26254420	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	29263092	★★★★★ ★☆☆☆☆ Found in Text Mining only

RBBP7 (RB binding protein 7, chromatin remodeling factor)