ACE2 (angiotensin converting enzyme 2)

Gene

• Entrez ID: 59272
• Gene name: Angiotensin converting enzyme 2
• Gene symbol: ACE2
• Synonyms (NCBI Gene): ACEH
• Chromosome: X
• Chromosome location: Xp22.2
• Summary: The protein encoded by this gene belongs to the angiotensin-converting enzyme family of dipeptidyl carboxydipeptidases and has considerable homology to human angiotensin 1 converting enzyme. This secreted protein catalyzes the cleavage of angiotensin I in

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030157	hsa-miR-26b-5p	Microarray	19088304
MIRT734665	hsa-miR-125b-5p	Microarray	33429366
MIRT734668	hsa-miR-200c-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32891636
MIRT755409	hsa-let-7b-5p	qRT-PCR	36073344
MIRT756132	hsa-miR-1246	Luciferase reporter assay, Western blotting, qRT-PCR	36851710
MIRT762451	hsa-miR-2052	CLIP-seq
MIRT762452	hsa-miR-300	CLIP-seq
MIRT762453	hsa-miR-3185	CLIP-seq
MIRT762454	hsa-miR-3545-3p	CLIP-seq
MIRT762455	hsa-miR-3611	CLIP-seq
MIRT762456	hsa-miR-381	CLIP-seq
MIRT762457	hsa-miR-4318	CLIP-seq
MIRT762458	hsa-miR-4424	CLIP-seq
MIRT762459	hsa-miR-4539	CLIP-seq
MIRT762460	hsa-miR-4682	CLIP-seq
MIRT762461	hsa-miR-4693-5p	CLIP-seq
MIRT762462	hsa-miR-4762-3p	CLIP-seq
MIRT762463	hsa-miR-4797-5p	CLIP-seq
MIRT762464	hsa-miR-514	CLIP-seq
MIRT762465	hsa-miR-514b-3p	CLIP-seq
MIRT762466	hsa-miR-892a	CLIP-seq
MIRT2165982	hsa-miR-2113	CLIP-seq
MIRT2165983	hsa-miR-4270	CLIP-seq
MIRT2165984	hsa-miR-4441	CLIP-seq
MIRT2165985	hsa-miR-483-3p	CLIP-seq
MIRT2165986	hsa-miR-587	CLIP-seq
MIRT2165987	hsa-miR-599	CLIP-seq
MIRT762451	hsa-miR-2052	CLIP-seq
MIRT762459	hsa-miR-4539	CLIP-seq
MIRT762462	hsa-miR-4762-3p	CLIP-seq
MIRT762463	hsa-miR-4797-5p	CLIP-seq
MIRT762464	hsa-miR-514	CLIP-seq
MIRT762465	hsa-miR-514b-3p	CLIP-seq
MIRT2435172	hsa-miR-4520a-3p	CLIP-seq
MIRT2435173	hsa-miR-4520b-3p	CLIP-seq
MIRT2435174	hsa-miR-4529-3p	CLIP-seq
MIRT2435175	hsa-miR-511	CLIP-seq
MIRT2435176	hsa-miR-9	CLIP-seq
MIRT2435172	hsa-miR-4520a-3p	CLIP-seq
MIRT2435173	hsa-miR-4520b-3p	CLIP-seq
MIRT2435174	hsa-miR-4529-3p	CLIP-seq
MIRT2435175	hsa-miR-511	CLIP-seq
MIRT2435176	hsa-miR-9	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HIF1A	Repression	19592460

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	16051304, 18343844, 33000221, 33082294
GO:0001618	Function	Virus receptor activity	IMP	24227843
GO:0001817	Process	Regulation of cytokine production	IC	15380922
GO:0002003	Process	Angiotensin maturation	IC	10924499
GO:0002003	Process	Angiotensin maturation	TAS
GO:0003051	Process	Angiotensin-mediated drinking behavior	IMP	18258853
GO:0003081	Process	Regulation of systemic arterial blood pressure by renin-angiotensin	IC	10924499
GO:0003081	Process	Regulation of systemic arterial blood pressure by renin-angiotensin	IMP	18258853
GO:0004175	Function	Endopeptidase activity	IDA	15283675
GO:0004180	Function	Carboxypeptidase activity	IDA	10924499, 10969042, 15283675, 15380922, 18258853
GO:0004181	Function	Metallocarboxypeptidase activity	EXP	10924499, 10969042, 11815627
GO:0005515	Function	Protein binding	IPI	10969042, 11815627, 14647384, 15479853, 15791205, 18343844, 18931070, 19185582, 19901337, 21068237, 21411533, 22291007, 22523556, 23486063, 23831647, 30102747, 30356097, 32075877, 32132184, 32155444, 32203189, 32225175, 32225176, 32275855, 32332765, 32376634, 32415260, 32437749, 326
GO:0005576	Component	Extracellular region	IDA	10969042
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	18258853
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	21068237
GO:0005886	Component	Plasma membrane	TAS
GO:0008237	Function	Metallopeptidase activity	IBA	21873635
GO:0008237	Function	Metallopeptidase activity	IDA	10924499
GO:0008241	Function	Peptidyl-dipeptidase activity	IDA	10924499
GO:0008270	Function	Zinc ion binding	TAS	10924499
GO:0009986	Component	Cell surface	IDA	18343844, 24227843
GO:0015827	Process	Tryptophan transport	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	25534429
GO:0019229	Process	Regulation of vasoconstriction	IC	15380922
GO:0022898	Process	Regulation of transmembrane transporter activity	IGI	25534429
GO:0031526	Component	Brush border membrane	IDA	25534429
GO:0042127	Process	Regulation of cell population proliferation	TAS	17703127
GO:0045121	Component	Membrane raft	TAS	18279660
GO:0046718	Process	Viral entry into host cell	IDA	16051304, 32221306, 33000221, 33082294
GO:0046718	Process	Viral entry into host cell	TAS	15165741
GO:0046813	Process	Receptor-mediated virion attachment to host cell	IDA	18343844, 32221306
GO:0050727	Process	Regulation of inflammatory response	IC	15380922
GO:0051957	Process	Positive regulation of amino acid transport	IMP	19185582
GO:0060452	Process	Positive regulation of cardiac muscle contraction	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0097746	Process	Blood vessel diameter maintenance	IC	15380922
GO:1903598	Process	Positive regulation of gap junction assembly	IMP	12967627
GO:1903779	Process	Regulation of cardiac conduction	IMP	12967627
GO:1905737	Process	Positive regulation of L-proline import across plasma membrane	IGI	25534429
GO:2000272	Process	Negative regulation of signaling receptor activity	IMP	18258853
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IC	15380922

Other IDs

• MIM: 300335
• HGNC: 13557
• e!Ensembl: ENSG00000130234

Protein

• UniProt ID: Q9BYF1
• Protein name: Angiotensin-converting enzyme 2 (EC 3.4.17.23) (Angiotensin-converting enzyme homolog) (ACEH) (Angiotensin-converting enzyme-related carboxypeptidase) (ACE-related carboxypeptidase) (EC 3.4.17.-) (Metalloprotease MPROT15) [Cleaved into: Processed angioten
• Protein function: Essential counter-regulatory carboxypeptidase of the renin-angiotensin hormone system that is a critical regulator of blood volume, systemic vascular resistance, and thus cardiovascular homeostasis (PubMed:27217402). Converts angiotensin I to an
• PDB: 1R42, 1R4L, 2AJF, 3D0G, 3D0H, 3D0I, 3KBH, 3SCI, 3SCJ, 3SCK, 3SCL, 6ACG, 6ACJ, 6ACK, 6CS2, 6LZG, 6M0J, 6M17, 6M18, 6M1D, 6VW1, 7A91, 7A92, 7A94, 7A95, 7A96, 7A97, 7A98, 7BH9, 7CT5, 7DDO, 7DDP, 7DF4, 7DMU, 7DQA, 7DRV, 7DWX, 7DX4, 7DX5, 7DX6, 7DX7, 7DX8, 7DX9, 7E7E, 7EDJ, 7EFP, 7EFR, 7EKC, 7EKE, 7EKF, 7EKG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01401	Peptidase_M2	19 → 606	Angiotensin-converting enzyme	Family
  PF16959	Collectrin	617 → 770	Renal amino acid transporter	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in endothelial cells from small and large arteries, and in arterial smooth muscle cells (at protein level) (PubMed:15141377). Expressed in enterocytes of the small intestine, Leydig cells and Sertoli cells (at protein level)
• Sequence:

  MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ
  NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL
  NTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY
  EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHL
  HAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
  AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILM
  CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
  IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM
  KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLH
  KCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK
  NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKN
  QMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN
  SLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENP
  YASIDISKGENNPGFQNTDDVQTSF

• Sequence length: 805

Pathways

KEGG:

Renin-angiotensin system
Protein digestion and absorption
Coronavirus disease - COVID-19

Reactome:

Metabolism of Angiotensinogen to Angiotensins

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Aortic aneurysm	Aortic Aneurysm, Abdominal	rs1555554098, rs267606902, rs121434526, rs121434527, rs121434528, rs387906592, rs387906781, rs387906782, rs397516685, rs397514037, rs112901682, rs397515325, rs397515330, rs794728025, rs112602953, rs794728021, rs8046180, rs797045725, rs876657852, rs878854466, rs886038978, rs746972765, rs886039303, rs886040965, rs886040966, rs886040967, rs886229659, rs1553781304, rs1060502531, rs1553795301, rs1553803235, rs1213452826, rs869025352, rs1553780501, rs1553785222, rs1382893400, rs1554841990, rs1430822242, rs1567692384, rs1576422965, rs1596712899, rs2059732940, rs2041090817, rs1439991530	25301841
Hypertension	Hypertensive disease	rs13306026	17473847, 20559404, 19221212, 15833808
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315, rs121918316, rs397515320, rs121434489, rs1585215916, rs267607233, rs267606752, rs137852214, rs606231193, rs132630297, rs80338758, rs137852815, rs122455132, rs28935171, rs122453113, rs122445108, rs28934904, rs28934908, rs28935468, rs61748421, rs121918624, rs202060209, rs80338708, rs113994198, rs199422192, rs387906635, rs1554770064, rs1057519611, rs1060499526, rs387906636, rs1057519612, rs281875189, rs281875322, rs387906799, rs387906804, rs875989800, rs797045262, rs387906845, rs387906846, rs876657378, rs281875227, rs281875228, rs281875229, rs281875230, rs387906861, rs370667926, rs387906932, rs387906943, rs1557612719, rs387907190, rs387907191, rs2126499522, rs587776908, rs1560982564, rs80359505, rs398123009, rs587776929, rs587776930, rs397514555, rs398122824, rs398122825, rs397514556, rs2147483647, rs587776937, rs397514627, rs397514655, rs397514656, rs730882192, rs1587520018, rs1581995953, rs1554121970, rs1581987445, rs397514670, rs376395543, rs137854128, rs397509411, rs397509412, rs397514741, rs398122394, rs879255516, rs397518483, rs398122406, rs398122412, rs398123561, rs200667343, rs587777162, rs587777202, rs62507350, rs587777219, rs587777225, rs587777226, rs587779750, rs587777326, rs587777334, rs281875332, rs587780470, rs587780474, rs587780486, rs587777378, rs587777406, rs587777408, rs587777409, rs587777411, rs587777522, rs527236034, rs527236035, rs267608571, rs267608382, rs267608597, rs61753979, rs61751444, rs267608493, rs587777644, rs587777645, rs587777646, rs587777703, rs587779388, rs606231266, rs606231267, rs672601340, rs606231268, rs672601341, rs606231269, rs672601342, rs606231270, rs606231271, rs606231272, rs606231273, rs587784566, rs587784092, rs587783749, rs587783747, rs587783640, rs587783483, rs606231456, rs606231457, rs606231458, rs606231459, rs672601370, rs672601369, rs672601371, rs672601367, rs672601366, rs672601365, rs672601364, rs672601363, rs672601362, rs672601376, rs672601377, rs672601378, rs724159949, rs724159950, rs724159948, rs724159956, rs724159953, rs727502860, rs727502861, rs730882197, rs749995448, rs786205143, rs794726770, rs1135401808, rs786205583, rs786205595, rs786205859, rs794727792, rs794727928, rs794729221, rs797044519, rs797044523, rs797044521, rs797044524, rs797044526, rs797044522, rs797044520, rs794727642, rs796052719, rs781746113, rs796052510, rs796052733, rs796052724, rs796052728, rs796052676, rs796053353, rs796053366, rs796053368, rs1555103986, rs1555110818, rs796052571, rs1555110843, rs796052626, rs796052618, rs796053290, rs796052217, rs672601368, rs797045164, rs797044961, rs797044962, rs200070245, rs797044963, rs869320675, rs869320676, rs797045012, rs752746786, rs797044885, rs797044925, rs797044854, rs797044849, rs797044930, rs797044901, rs797044918, rs797044884, rs797045177, rs797045178, rs797045050, rs797045036, rs797045053, rs797045047, rs797045037, rs797045042, rs797045041, rs879255261, rs782397980, rs797045263, rs797045264, rs797045655, rs797045586, rs545185248, rs797046031, rs797046028, rs797046029, rs797046030, rs797045249, rs797045529, rs797045952, rs797045984, rs797045540, rs797045539, rs797045989, rs863224930, rs869025202, rs863225264, rs863225077, rs876661308, rs869025222, rs864309560, rs758252808, rs745756308, rs869025286, rs869025287, rs869025578, rs143038880, rs869025579, rs869025580, rs869025581, rs869312704, rs869312674, rs869312677, rs869312689, rs869312693, rs869312698, rs869312708, rs869312711, rs869312826, rs869312825, rs869312824, rs869312823, rs758432471, rs869312821, rs761993070, rs869312844, rs869312842, rs869312843, rs869312841, rs869312847, rs869320632, rs869312955, rs773432002, rs869320713, rs869320772, rs869320773, rs879255270, rs875989848, rs875989849, rs1716457622, rs2108414289, rs878854401, rs875989786, rs1085307109, rs1085307108, rs876657679, rs876661167, rs876661076, rs876661055, rs876661219, rs876661064, rs876661151, rs876661041, rs200440467, rs876661295, rs878853045, rs878853143, rs878853142, rs878853149, rs1555910048, rs878853152, rs878853146, rs878853145, rs878853141, rs878853151, rs878853144, rs878853148, rs878853147, rs878853251, rs878853269, rs879253762, rs886037841, rs879253888, rs879253931, rs879254016, rs879255618, rs879255619, rs879255620, rs886037847, rs879255621, rs886039332, rs746177928, rs886039520, rs886041003, rs886041058, rs750035706, rs886041059, rs886041060, rs886041061, rs886041090, rs886041088, rs886041089, rs886041095, rs886041097, rs886041989, rs886041944, rs886041692, rs886041593, rs886041687, rs886041207, rs886041309, rs886041239, rs886041448, rs138336847, rs149644940, rs886041295, rs886041521, rs886041125, rs886042041, rs886041238, rs886041469, rs886041197, rs886041291, rs886041658, rs886041705, rs886041876, rs139716296, rs1057516030, rs1057517408, rs749655461, rs141179774, rs370916968, rs1057517676, rs1057517933, rs1057517708, rs1057518352, rs1057518183, rs1057518474, rs1057518204, rs1057517825, rs1057518796, rs1057518961, rs1057518772, rs1057518988, rs1057519004, rs1057518700, rs772450541, rs371310428, rs1057519019, rs1057519491, rs1057519546, rs1057519560, rs1057519565, rs1057519400, rs1057519402, rs1057519405, rs1057519593, rs1057519594, rs1057519628, rs1556912828, rs1060505029, rs1060505030, rs147001633, rs1057519947, rs1057519617, rs1057524832, rs774592932, rs797045045, rs1039571136, rs1555910821, rs1060499626, rs1060499655, rs1554770185, rs1060499936, rs1060501153, rs1060501151, rs1064792984, rs1060503378, rs1060503386, rs1060503383, rs1060500046, rs1064792999, rs1060505033, rs1064796564, rs1064797002, rs1064793161, rs150802299, rs1064796830, rs1064794996, rs1064795444, rs1064796034, rs1064796403, rs1064794979, rs1064796765, rs1064793539, rs760933323, rs1064793546, rs1064796406, rs1064796367, rs780441716, rs1064794894, rs1064796023, rs1064797355, rs1085307484, rs1064794935, rs1085307547, rs1131690804, rs757511770, rs1131691875, rs1131691979, rs398122823, rs1131691866, rs1131692159, rs1131692228, rs1131692154, rs113331868, rs1554121872, rs1554121875, rs926027867, rs1554122123, rs1554122129, rs1287121256, rs1554122526, rs1554123982, rs1554385102, rs1554385111, rs1554385305, rs1554386687, rs1554389088, rs1554402092, rs1554434435, rs1135401778, rs1135401760, rs1135401770, rs1135401771, rs1135401768, rs1135401779, rs1135401805, rs1135401797, rs1135401799, rs1135401816, rs1135401823, rs1135401824, rs1555769968, rs1135401825, rs1135401955, rs1135401956, rs1135401957, rs1135401958, rs1554129040, rs1554150543, rs1553188463, rs1553146165, rs1485978447, rs1361547443, rs750079325, rs369692236, rs1554231836, rs749188610, rs1554122735, rs1554689877, rs1174482090, rs781053477, rs1554623112, rs1555409836, rs1555411305, rs770014321, rs1555984461, rs1555990958, rs762292772, rs1554944271, rs1057524157, rs1485749468, rs1555984343, rs1293450628, rs373584239, rs1553722309, rs1553738686, rs1376334317, rs1553722294, rs1553283831, rs1554120589, rs1555985554, rs1555877287, rs1555411378, rs750922282, rs1553264873, rs1554263326, rs1554264268, rs1554263626, rs1554263625, rs766614772, rs1553620494, rs1555050158, rs1555050165, rs1555050171, rs1555050174, rs765556214, rs1402086660, rs1554645052, rs1555661648, rs1293246328, rs749494995, rs775592405, rs1553265189, rs1553242856, rs1553247374, rs1553241570, rs1553997065, rs1553998565, rs1380822792, rs1555028154, rs1555023232, rs1553194155, rs1553130904, rs1553152590, rs1553567864, rs1553638614, rs120074160, rs1554486894, rs1554767754, rs1554843977, rs1555443581, rs1555443600, rs1555439545, rs1555525088, rs770680174, rs1555889130, rs373178770, rs1555985532, rs1553519853, rs781325598, rs1410587479, rs1553638086, rs150259543, rs1554093891, rs1554121228, rs1554120498, rs1554121189, rs1212517874, rs1554770628, rs1555979158, rs1554770054, rs771610568, rs1451230055, rs1554770624, rs1555906707, rs1555906768, rs1555906781, rs1555907620, rs1555907623, rs1555907626, rs1555907653, rs1555907864, rs1554094145, rs1554202698, rs1554200722, rs773327091, rs1555607621, rs1555604778, rs1555607159, rs1555607682, rs1553364018, rs1553324416, rs1555411394, rs1554102556, rs1554122363, rs1555705966, rs1555103971, rs1555408401, rs1554461593, rs1554304254, rs1554120978, rs1047509819, rs1555982601, rs767774867, rs1554789246, rs1555111511, rs1555950676, rs1555954380, rs1555985649, rs1553194162, rs1553518509, rs1274633498, rs1554274371, rs1554122252, rs1554122458, rs1554122729, rs1554297905, rs1554776342, rs1554770046, rs1554770667, rs1554792556, rs1452715535, rs1555444885, rs1555534147, rs1427624649, rs1555611722, rs1555744282, rs1555706391, rs1178702025, rs1555984102, rs1554770589, rs1554121443, rs1559791842, rs1559824939, rs1555889127, rs1236702036, rs1553510280, rs1553511175, rs1553511226, rs1554150552, rs1554275163, rs1554201137, rs1553517991, rs1553518511, rs1553517984, rs1553518752, rs1554119814, rs1554122293, rs1554122341, rs1554122689, rs1554770243, rs1554770444, rs1557045250, rs959316981, rs1556270312, rs1553270640, rs978179634, rs1554093884, rs1491240980, rs1555943484, rs1554121453, rs1334099693, rs1554048616, rs1555660806, rs1555644480, rs1555651572, rs1567844992, rs1567855081, rs1567855669, rs1567855704, rs1567856045, rs1567856331, rs1567860075, rs1567860112, rs1567860640, rs1567860891, rs754919272, rs1567860919, rs1567861468, rs1567861489, rs1567861501, rs1567861894, rs1567863732, rs1567864750, rs1567877108, rs1567878511, rs758785463, rs1553808301, rs1553245038, rs1553789166, rs1553813646, rs1553631860, rs1554121265, rs1554770262, rs1555034768, rs1555984433, rs779009256, rs1553994814, rs1553996086, rs1553996072, rs1553270599, rs1553153291, rs760262127, rs1554119274, rs1554121878, rs1554387293, rs1554385203, rs757077698, rs750612085, rs1554776500, rs1564360978, rs1554776933, rs1554776938, rs1565278132, rs1567368243, rs1558478047, rs375695605, rs1558479778, rs1558501648, rs1565240833, rs114727354, rs1557591264, rs1557620758, rs1559099927, rs1561788984, rs369459721, rs1563831738, rs1562159088, rs1562159562, rs1562159599, rs1559094754, rs1559328283, rs755634856, rs1561784687, rs1554122296, rs1561789313, rs1562720119, rs1564363665, rs1561697465, rs1561785003, rs1561787845, rs1561789215, rs1554122305, rs1561784553, rs1561784560, rs1561787690, rs1554122888, rs749632782, rs1567139896, rs1569370887, rs1569371303, rs1564493599, rs1561875779, rs1569146542, rs1569146649, rs1275489527, rs1560115921, rs1468772495, rs749969789, rs1560108090, rs1569376809, rs1569355102, rs1560103306, rs1564365418, rs1559855453, rs1562928193, rs1558149913, rs1253072668, rs141976414, rs1558371790, rs1557898800, rs1567758622, rs1567844041, rs1567844114, rs1567920106, rs1567920209, rs138247472, rs1567974030, rs1567995650, rs1283838287, rs1568003569, rs1568006217, rs1568018905, rs1562505675, rs1561783309, rs1555980234, rs1559087186, rs1560966086, rs1560330387, rs769471341, rs1562493608, rs1562505335, rs1554121861, rs1554122200, rs1562957809, rs1568097623, rs1391600900, rs1568234874, rs1568235086, rs1555990955, rs1567870541, rs1557570794, rs1562869207, rs1571818248, rs1431778557, rs369691608, rs1595808957, rs1597665063, rs1597846084, rs1603401125, rs1603350606, rs1601946481, rs1601932069, rs1602880906, rs1602308324, rs1574554519, rs1573882268, rs1603198937, rs1558148010, rs1558498928, rs1569459580, rs1569380375, rs1560062082, rs1557889974, rs1558414255, rs756429763, rs781663444, rs1569016820, rs1569017025, rs1569017160, rs1557612048, rs1568504941, rs1581987022, rs1576983339, rs1599892470, rs1265340906, rs1602284689, rs1574949440, rs1576220938, rs1576280892, rs1576288424, rs1574459612, rs1574511051, rs1575654528, rs1577094794, rs1294683568, rs771819481, rs1580984895, rs1581338441, rs1580988138, rs1581980317, rs1581986872, rs1554121207, rs1581987268, rs1581987476, rs1581987885, rs763770519, rs1581991929, rs1581992099, rs1581992998, rs1581995453, rs1554122242, rs1581996778, rs1581997228, rs1588735247, rs1555980467, rs1555985742, rs1601319086, rs1601970168, rs1574451881, rs876661168, rs1576994053, rs1573589807, rs1581036396, rs1601267617, rs1572531830, rs1573483715, rs1590954686, rs1601315812, rs1573965358, rs1573972562, rs529087882, rs1570609440, rs1598940393, rs1575333081, rs1576028676, rs1596476657, rs1599375711, rs1603290366, rs1603060007, rs1603069440, rs1592939069, rs1591612223, rs2062994512, rs373701249, rs1600471396, rs1600501018, rs1600504088, rs1600514073, rs748436953, rs765723607, rs758170522, rs1561785045, rs1357591960, rs1591609136, rs1596891223, rs1579370234, rs2047850664, rs1579109565, rs1870202051, rs1574887674, rs778229060, rs1572531281, rs1570622663, rs1573501865, rs1576086299, rs1576164991, rs1574907198, rs1576656734, rs1554121438, rs1581995425, rs1581996813, rs1582001015, rs1588324025, rs1591371152, rs1590008294, rs1590956245, rs1590028691, rs1591606580, rs1591611001, rs1591612317, rs1591612370, rs763436882, rs997044541, rs1595897117, rs747706524, rs1579377990, rs1201878175, rs1894051550, rs1572531730, rs1579576029, rs1577017863, rs752545577, rs1582461267, rs1589460606, rs1588727276, rs1598620094, rs1599368323, rs1600082188, rs1601319352, rs1598226304, rs2076013475, rs2076017638, rs1600596180, rs1554121932, rs1680676671, rs1570607996, rs1382444181, rs1570640673, rs1574994308, rs1596667777, rs1602226289, rs1595629181, rs1595609005, rs1227643933, rs1572705473, rs1570621899, rs1722830922, rs1575094649, rs1417035592, rs1581997098, rs1589457762, rs1598211790, rs758726258, rs1601071971, rs863224922, rs1586692481, rs1586692548, rs1586692551, rs1580988074, rs1594129609, rs1588732344, rs1579368865, rs1586660389, rs1586660370, rs1586660338, rs1586657848, rs1586660381, rs1791701214, rs752676391, rs1680673822, rs758098717, rs1726676630, rs762288077, rs1759964009, rs1760905766, rs1761021165, rs1554121934, rs2055849544, rs1049773, rs587784300, rs1861628072, rs1761241410, rs1064797322, rs1948652423, rs2059194330, rs1777174302, rs2054280202, rs2081190512, rs772665884, rs1400164869, rs1861593395, rs1760897843, rs1761087122, rs1388355040, rs2068797192, rs1777175608, rs376898131	26350204

Associations from Text Mining
Disease Name	Relationship Type	References
Acute Kidney Injury	Associate	36751832
Acute Lung Injury	Associate	19021774, 24662240
Adenocarcinoma	Stimulate	32639084
Adenocarcinoma	Associate	33061814, 33231569, 36759514
Adenocarcinoma Mucinous	Associate	34590603
Adenocarcinoma of Lung	Associate	32366279, 33061814, 33422520, 34480250, 37553526
Adenocarcinoma of Lung	Stimulate	32492203, 32639084, 32916258, 33429366
Ageusia	Associate	36250059
Allergic Fungal Sinusitis	Associate	33928889
Allergic Fungal Sinusitis	Inhibit	34232770
Alzheimer Disease	Inhibit	27884212, 37183346
Alzheimer Disease	Stimulate	33567524, 34628788
Alzheimer Disease	Associate	34115612, 38257800
Anemia	Associate	33497931
Angina Pectoris	Associate	23077079
Aortic Aneurysm Thoracic	Associate	25237166
Aortic Dissection	Associate	25237166
Aortic Valve Stenosis	Inhibit	31607667
Arthritis Psoriatic	Associate	33300150
Asthma	Associate	32348692, 32496587, 32531372, 34198852, 34503323, 35111161, 36038007, 37506151
Asthma	Inhibit	32422146, 33455043
Asthma	Stimulate	33413387
Atherosclerosis	Associate	19021774, 20798044, 28186543
Atherosclerosis	Inhibit	20798044
Atrial Fibrillation	Associate	30542083, 32984892, 33602129
Atrial Remodeling	Associate	30542083, 38138974
Atrial Remodeling	Inhibit	31607667
Atrophy	Associate	34097714
Azoospermia	Associate	32361911
Bacterial Infections	Associate	34112226
Barrett Esophagus	Associate	36759514
Blood Coagulation Disorders	Associate	33248385, 36560757, 38497867
Blood Platelet Disorders	Associate	34445266, 35320941
Brain Diseases	Associate	34416267, 35901083
Brain Injuries	Associate	32635188
Brain Injuries Diffuse	Associate	35260724
Breast Neoplasms	Associate	33061814, 33517235, 36335375
Breast Neoplasms	Inhibit	35373393
Carcinoma Basal Cell	Associate	34471421
Carcinoma Hepatocellular	Associate	33061814, 35115564
Carcinoma Hepatocellular	Stimulate	33421977
Carcinoma Hepatocellular	Inhibit	34369278
Carcinoma Non Small Cell Lung	Associate	35960376
Carcinoma Pancreatic Ductal	Inhibit	19212105
Carcinoma Renal Cell	Associate	28809959, 32339157, 33274196, 33916968
Carcinoma Renal Cell	Stimulate	32366279, 32639084
Carcinoma Renal Cell	Inhibit	33390830
Carcinoma Squamous Cell	Stimulate	32492203, 32639084
Carcinoma Squamous Cell	Associate	32916258, 33231569
Cardiomyopathies	Stimulate	15151696, 35012625
Cardiomyopathy Dilated	Stimulate	15151696, 25869724, 35138176
Cardiomyopathy Hypertrophic	Associate	18560893, 32448590
Cardiotoxicity	Associate	38295140
Cardiovascular Diseases	Associate	18403595, 25237166, 30227878, 30347406, 31607667, 32227090, 32305506, 32430651, 32664879, 32795091, 32882331, 33017071, 33251580, 33280062, 33933634, 34001841, 34051791, 35709192, 36125178, 37404175, 37454747, 37644110, 38074420, 38213254
Carotid Stenosis	Associate	30227878
Cataract	Associate	19384013
Central Nervous System Diseases	Associate	32635188
Cerebral Infarction	Associate	30342552
Cerebral Palsy	Associate	35105380
Cerulean cataract	Associate	36965551
Charcot Marie Tooth disease Type 1D	Associate	35045143
Chorioamnionitis	Stimulate	34359894
Chronic Disease	Stimulate	32639084
Chronic Kidney Disease Mineral and Bone Disorder	Inhibit	28186543
Chronic Kidney Disease Mineral and Bone Disorder	Associate	32756181
Cognition Disorders	Associate	36250059
Colitis Ulcerative	Stimulate	33160965
Colonic Neoplasms	Associate	22048948, 33765612
Colonic Neoplasms	Stimulate	32366279, 32639084, 33421977, 34257580
Colorectal Neoplasms	Associate	32675312
Colorectal Neoplasms	Stimulate	33765612, 34257580
Communicable Diseases	Associate	32497323
Congenital contractural arachnodactyly	Associate	37454747
Corneal Diseases	Associate	33049061
Coronary Artery Disease	Associate	29897923
Coronary Disease	Associate	24142614
Coronary Stenosis	Associate	23077079
Coronavirus Infections	Associate	32405156, 33210300, 33979123, 34031435, 34535662, 34668773, 34937861, 35260724, 35938548, 36877757, 37098810, 37929242, 38257800
Coronavirus Infections	Stimulate	33046696
COVID 19	Associate	14983044, 15221932, 15316659, 15937940, 16282461, 17031779, 19853613, 20484496, 24227843, 26487711, 30356097, 32094336, 32170560, 32268515, 32269089, 32276140, 32290077, 32303424, 32305506, 32311451, 32329408, 32334082, 32339157, 32345362, 32348692, 32350104, 32374427, 32390091, 32396773, 32410735, 32423095, 32428380, 32428864, 32430651, 32432483, 32433344, 32448590, 32452762, 32455539, 32468052, 32496587, 32501810, 32503822, 32503918, 32512290, 32531372, 32544566, 32545271, 32558150, 32565362, 32569293, 32573788, 32582222, 32591666, 32593740, 32594644, 32598305, 32623546, 32633594, 32633718, 32635188, 32639084, 32643448, 32661206, 32663742, 32664879, 32668165, 32669955, 32673940, 32675206, 32675312, 32681121, 32705281, 32710986, 32715618, 32715628, 32721809, 32726325, 32729248, 32735992, 32744436, 32754161, 32755325, 32758869, 32759995, 32760206, 32762417, 32777054, 32790406, 32791137, 32810867, 32815593, 32817004, 32825469, 32841599, 32861340, 32862058, 32882331, 32883368, 32894568, 32899439, 32905897, 32916258, 32917283, 32917504, 32934806, 32949179, 32964802, 32968798, 32969768, 32981365, 32984892, 32996784, 33006605, 33025553, 33032170, 33038424, 33044654, 33046696, 33049061, 33060154, 33065163, 33073716, 33074885, 33077916, 33081421, 33093202, 33104520, 33112891, 33124193, 33125431, 33135055, 33137894, 33148439, 33156843, 33160965, 33161843, 33163005, 33174446, 33174669, 33181224, 33190150, 33191068, 33207244, 33210300, 33210357, 33218024, 33221759, 33231569, 33243086, 33246692, 33253796, 33254538, 33254543, 33254553, 33254575, 33254579, 33274196, 33280254, 33281748, 33305659, 33306581, 33315853, 33318519, 33341869, 33370311, 33379366, 33386398, 33388749, 33390830, 33396837, 33401657, 33402434, 33407110, 33418950, 33421977, 33422520, 33422990, 33423311, 33429366, 33434105, 33452303, 33458761, 33472206, 33481336, 33488517, 33500718, 33506503, 33506945, 33521687, 33525415, 33525682, 33526974, 33543899, 33564039, 33576464, 33611766, 33629341, 33662681, 33662863, 33691446, 33694125, 33704002, 33707526, 33712587, 33733740, 33738989, 33756485, 33765612, 33767405, 33774023, 33796097, 33797339, 33818000, 33819740, 33823179, 33836338, 33837377, 33846513, 33851521, 33853968, 33879756, 33880537, 33883027, 33884270, 33928889, 33933634, 33958627, 33978304, 33979123, 33979391, 34001841, 34003736, 34009691, 34016740, 34030677, 34045585, 34047452, 34064066, 34073591, 34074219, 34079039, 34102107, 34112801, 34115612, 34118974, 34137173, 34140558, 34146659, 34147856, 34171382, 34185793, 34194422, 34198852, 34233672, 34252054, 34257394, 34257580, 34270613, 34273271, 34274504, 34282405, 34287040, 34289058, 34293137, 34299155, 34299289, 34324210, 34330889, 34346317, 34356057, 34359878, 34369278, 34375715, 34402717, 34403037, 34405821, 34410305, 34410424, 34412632, 34416267, 34416856, 34417262, 34428371, 34434902, 34441050, 34454610, 34465913, 34470994, 34471195, 34479494, 34480250, 34514615, 34517212, 34528526, 34531369, 34535662, 34578296, 34578338, 34590312, 34592572, 34606834, 34628788, 34646263, 34653711, 34668773, 34674152, 34714440, 34730438, 34735736, 34757528, 34769056, 34798263, 34862332, 34873039, 34895256, 34895312, 34914393, 34915409, 34915475, 34915500, 34918095, 34934117, 34937861, 34954105, 34956213, 34960655, 34972736, 34994082, 34995294, 34995811, 34999004, 35003077, 35011584, 35012625, 35027731, 35029877, 35032553, 35045143, 35046647, 35065253, 35111161, 35115564, 35120165, 35129839, 35181735, 35185890, 35190362, 35196166, 35200677, 35216056, 35220822, 35231079, 35235558, 35241825, 35250987, 35260724, 35261286, 35305693, 35360113, 35453047, 35454161, 35505068, 35524548, 35548940, 35561674, 35563345, 35563515, 35597364, 35623072, 35688117, 35688710, 35708281, 35712238, 35738053, 35739259, 35743089, 35747501, 35779308, 35788318, 35793758, 35809511, 35816517, 35822676, 35836103, 35840993, 35861636, 35862965, 35885894, 35891433, 35915083, 35937703, 35938548, 35964366, 35967361, 35969900, 35996506, 36029284, 36038007, 36056420, 36057605, 36075471, 36112976, 36146667, 36146867, 36150393, 36163411, 36193902, 36200913, 36217700, 36220880, 36228039, 36231922, 36250059, 36255490, 36258658, 36279285, 36303053, 36334362, 36334414, 36335375, 36336003, 36360172, 36362417, 36366484, 36366497, 36379742, 36399443, 36495008, 36499094, 36511187, 36513710, 36567123, 36579345, 36584595, 36611805, 36613459, 36628848, 36689652, 36751832, 36757924, 36757984, 36759535, 36769357, 36806094, 36806814, 36877757, 36898276, 36914430, 36969980, 36972680, 36979408, 37002634, 37031303, 37043472, 37043739, 37060024, 37093365, 37098810, 37109672, 37141092, 37172190, 37217661, 37270678, 37287057, 37308887, 37312735, 37312742, 37326579, 37328914, 37442134, 37477828, 37497655, 37506151, 37515185, 37553526, 37556857, 37567834, 37569522, 37579743, 37628764, 37632105, 37640791, 37644110, 37667339, 37701824, 37761938, 37775095, 37806990, 37816037, 37894561, 37896870, 37929242, 37967509, 38032879, 38074420, 38095392, 38162580, 38185627, 38203850, 38263160, 38279353, 38295140, 38307396, 38310477, 38334329, 38367677, 38497867, 38511328, 38570058, 39175256, 39183295, 39192998, 39218301, 39273444, 39280326, 39337407, 39375326, 39941135, 39958440, 40076720
COVID 19	Stimulate	32664949, 33249290, 33394891, 33503446, 33673459, 34061395, 34076792, 34311326, 34406302, 34449302, 35008594, 35105380, 35661534, 35862802, 35864532, 35901083, 36073344, 36656205, 37896870, 38257800
COVID 19	Inhibit	32758871, 33025046, 33284859, 33432247, 33853637, 34112226, 34140558, 34200325, 34503323, 34626364, 34670172, 34935423, 35533364, 36625725, 37222866, 37686360
Critical Illness	Associate	32227090, 33249290, 33488517, 35250987, 37553526
Critical Illness	Stimulate	32390091
Crohn Disease	Associate	32915959, 34188154
Crohn Disease	Stimulate	33156843
Crohn Disease	Inhibit	33160965
Cystic Fibrosis	Stimulate	32668165
Cystic Fibrosis	Associate	36627352, 37579743
Cytokine Release Syndrome	Associate	32497323, 33694125, 34248968
Cytokine Release Syndrome	Stimulate	34224085
Death	Inhibit	34626364
Death	Associate	35120165, 35250987
Dementia	Stimulate	33053430
Dementia	Associate	36334414
Diabetes Complications	Associate	33254575, 35806251
Diabetes Gestational	Associate	30347406, 36531495
Diabetes Mellitus	Associate	19021774, 19333547, 30227878, 32344305, 32729248, 32981365, 33254553, 33254575, 33506503, 33602129, 33796097, 33933634, 33962629, 34086044, 34416856, 34471195, 35120165, 35305693, 35932065, 37308887, 37644110
Diabetes Mellitus	Inhibit	19034303, 35260304
Diabetes Mellitus	Stimulate	29561187, 32348692, 32917504, 33251580, 34417262, 35561674
Diabetes Mellitus Type 1	Associate	35260304
Diabetes Mellitus Type 2	Inhibit	19034303, 32558150
Diabetes Mellitus Type 2	Associate	20592051, 24142614, 25359286, 27500554, 29561187, 30227878, 33602129, 34067683, 35176079, 35250987, 37274884, 38034011, 38095392
Diabetes Mellitus Type 2	Stimulate	32639084, 33251580, 35660807
Diabetic Nephropathies	Associate	19034303, 27775793, 32917504, 33038424, 34086044, 35176079
Diabetic Retinopathy	Associate	34086044
Diarrhea	Stimulate	35398299
digital ulcers	Associate	37404175
Disease	Associate	32758871
Drug Hypersensitivity	Inhibit	33025046
Duane Retraction Syndrome	Associate	25359286
Dyslipidemias	Associate	30227878, 30342552
Embolic Stroke	Associate	33602129
Encephalitis Herpes Simplex	Associate	39259045
Endometrial Neoplasms	Stimulate	32339157
Endometrial Neoplasms	Associate	32639084, 33061814
Eosinophilic Esophagitis	Inhibit	33394891
Esophageal Squamous Cell Carcinoma	Stimulate	32639084
Essential Hypertension	Associate	16866021, 24112034, 30335025, 30342552, 30542083, 34996340, 35130889, 39512695
Essential Hypertension	Stimulate	30307755
Failed Back Surgery Syndrome	Associate	15151696
Fatty Liver	Associate	34520633
Fetal Growth Retardation	Inhibit	40222298
Fever	Associate	35703556
Fibrosis	Inhibit	31607667
Fibrosis	Associate	32598305, 32664949, 34097714, 34369278, 40237197
Folate Malabsorption Hereditary	Associate	36877757
Gastrointestinal Diseases	Associate	37404175, 37461168
Genetic Predisposition to Disease	Associate	32492203
Genital Diseases Male	Associate	32594644, 34204705
Glioblastoma	Associate	35595082
Glomerulonephritis	Associate	19034303
Glomerulonephritis IGA	Associate	34759147
Glomerulosclerosis Focal Segmental	Associate	34097714
Growth Disorders	Inhibit	35909539
Hashimoto Disease	Stimulate	36362417
Heart Defects Congenital	Associate	33280062, 37454747
Heart Diseases	Associate	15151696, 30335025, 33421274, 33662681, 35046458, 35138176, 35996506
Heart Failure	Associate	15151696, 25869724, 27412778, 29897923, 32227090, 32981365, 33280062, 34390216, 35046458, 38138974
Heart Failure	Stimulate	35138176
Heart Injuries	Associate	32227090
Heart Valve Diseases	Inhibit	31607667
Hematologic Diseases	Associate	33223324
Hemolytic Uremic Syndrome	Stimulate	28186543
Hemolytic Uremic Syndrome	Inhibit	33255902
Hemorrhoids	Associate	37932969
HIV Infections	Inhibit	34252054
HIV Infections	Stimulate	34325716
Hyperaldosteronism	Associate	33657582
Hyperoxia	Inhibit	27093376
Hypertension	Associate	16459167, 21298017, 25143330, 27310975, 30542083, 31430320, 32496587, 32639084, 32721806, 32729248, 33254553, 33386398, 33412808, 33506503, 33883027, 33933634, 35120165, 35250987, 35548940, 35996506, 36495008, 37274884, 37667339
Hypertension	Inhibit	18403595
Hypertension	Stimulate	33053430, 34051791, 34674152
Hypertension Pulmonary	Associate	19592460, 37454747
Hypertensive Nephropathy	Inhibit	18403595
Hypertensive Retinopathy	Associate	25359286, 34086044
Hypertriglyceridemia	Associate	30342552
Hypertrophy Left Ventricular	Associate	18560893
Hypogonadism	Associate	34471195
Hypotension	Associate	32633718, 33255902
Hypoxia	Associate	19592460, 24134599, 34416267, 34471421
Hypoxia	Stimulate	27093376, 32814566, 33497931, 34670172, 34929459, 36303053, 40222298
Hypoxia	Inhibit	34445747
Hypoxia Brain	Inhibit	34416267
Hypoxia Brain	Associate	34929459, 36335375
Infections	Associate	15897467, 15980414, 32249956, 32335334, 32423095, 32453494, 32502616, 32598305, 32726325, 32750256, 32810867, 32831104, 32882331, 32966582, 32968798, 33038424, 33093202, 33125431, 33138699, 33223324, 33246692, 33407110, 33423311, 33583326, 33592054, 33756485, 33823179, 34048708, 34140558, 34232770, 34270613, 34324210, 34359894, 34668773, 34735736, 34934117, 35003077, 35099061, 35113445, 35215888, 35235558, 35260724, 35343765, 35358182, 35401827, 35406799, 35503602, 35628365, 35632769, 35862965, 35891433, 35931765, 35937703, 36038007, 36056420, 36146667, 36279285, 36642382, 36749641, 36851526, 36993979, 37002634, 37039676, 37047702, 37149825, 37270678, 37515136, 37632105, 38162580, 38190651, 39280273, 39280326
Infections	Stimulate	33315853, 33419885, 35138176, 35353667, 35862802, 37256962
Infections	Inhibit	36573430, 36735698
Infertility Male	Associate	34204705
Inflammation	Associate	17906677, 19411314, 32293910, 32311451, 32422146, 32502616, 32531372, 32598305, 32777054, 33044654, 33049061, 33104520, 33160965, 33237619, 33281748, 33341869, 33503828, 33506503, 33506945, 33883027, 33928889, 34097714, 34232770, 34441050, 34520633, 34578296, 34646263, 34914393, 34999004, 35111161, 35115564, 35199397, 35226423, 35607951, 35645319, 35915083, 36258658, 36642382, 36951513, 37109672, 37640791
Inflammation	Inhibit	26862037, 32558150, 32668165, 33694125, 34471421, 35822676
Inflammation	Stimulate	32497323, 32915959, 33059040, 34248968
Inflammatory Bowel Diseases	Stimulate	24505094
Inflammatory Bowel Diseases	Associate	33156843, 33160965, 34697723
Influenza Human	Associate	33351086, 33419885
Insulin Resistance	Associate	17906677, 33254538
Intestinal Diseases	Associate	20398667, 35220822
Intestinal Pseudo Obstruction	Inhibit	33503828
Kidney Diseases	Associate	19021774, 19034303, 32744436, 32917504, 33464168, 33807151, 34097714, 34759147, 36751832, 39280326
Kidney Failure Chronic	Associate	23477970
Kidney Failure Chronic	Inhibit	34674152
Kidney Failure Chronic	Stimulate	35366343
Kidney Neoplasms	Associate	28809959
Latent Autoimmune Diabetes in Adults	Associate	37243229
Lead Poisoning Nervous System	Associate	38295140
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	35283406
Lipid Metabolism Disorders	Associate	34996340
Liver Diseases	Associate	35709192, 39192998, 39958440
Liver Failure	Associate	34520633
Liver Failure	Stimulate	39958440
Lung Diseases	Associate	17031779, 33061814, 33933634, 35220822, 35305693, 35822676
Lung Diseases	Inhibit	32668165
Lung Injury	Associate	16691016, 32428864, 32598305, 32758871, 32934806, 33190150, 33419885, 33676010, 34449302
Lung Neoplasms	Associate	32916258, 33767597, 34480250, 35082790
Lung Neoplasms	Stimulate	34674152
Lupus Erythematosus Systemic	Associate	32276140
Lymphangioleiomyomatosis	Associate	33060154
Lymphopenia	Associate	37002634
Malaria	Associate	38367677
Mental Fatigue	Associate	38069039
Metabolic Diseases	Associate	34520633
Metabolic Syndrome	Associate	16459167, 30347406
Migraine Disorders	Associate	35352942
Mitral Valve Insufficiency	Inhibit	30581499
Mouth Neoplasms	Stimulate	32562913
Mucocutaneous Lymph Node Syndrome	Associate	32721809
Multiple Organ Failure	Associate	32582222, 32639084
Muscular Atrophy Spinal	Associate	33190150
Muscular Dystrophy Congenital Megaconial Type	Associate	31607667
Muscular dystrophy congenital with central nervous system involvement	Associate	32635188
Myocardial Infarction	Associate	23077079, 24134599, 29897923, 32227090
Myocarditis	Associate	35046458
Myotonic Dystrophy	Associate	36038007
Mysophobia	Stimulate	33177276
Nasal Polyps	Associate	33210729, 34232770
Neoplasm Metastasis	Inhibit	33390830
Neoplasms	Associate	19212105, 28809959, 31642813, 32339157, 32366279, 32639084, 32664879, 32675312, 32760213, 32970391, 33061814, 33108902, 33231569, 33421977, 33517235, 33629341, 33707526, 33796097, 34339474, 34590603, 34719202, 35115564, 36335375, 36759535
Neoplasms	Inhibit	33390830
Neuroblastoma	Associate	34834998
Neuroendocrine Tumors	Associate	33786714
Neuroinflammatory Diseases	Associate	37686360
Neurologic Manifestations	Associate	32573788, 35503602, 35868344, 35901083
Non alcoholic Fatty Liver Disease	Stimulate	36366497
Nonsyndromic Holoprosencephaly	Associate	35524548
Obesity	Associate	32496587, 32593740, 32721806, 33251580, 33386398, 33412808, 33611766, 33883027, 34625660, 35250987, 36038007, 36217700, 36513710, 37047702, 37644110, 38213254, 39280273
Obesity	Inhibit	34674152
Obesity	Stimulate	35113445, 35660807
Oculocutaneous albinism type 2	Associate	34471421
Olfaction Disorders	Stimulate	32810867
Olfaction Disorders	Associate	32817004, 33246692
Orchitis	Inhibit	34678309
Organizing Pneumonia	Associate	30542083, 32758871
Ovarian Diseases	Associate	33231569
Ovarian Neoplasms	Associate	35622184
Overweight	Stimulate	32428380
Overweight	Inhibit	34674152
Overweight	Associate	36217700
Pancreatic Diseases	Associate	32334082
Pancreatic Neoplasms	Associate	19212105, 33231569
Pancreatic Neoplasms	Stimulate	32366279
Pancreatitis	Associate	34282405
Parkinson Disease	Associate	35107828, 37686360
Pdgfra Associated Chronic Eosinophilic Leukemia	Inhibit	33928889
pediatric multisystem inflammatory disease COVID 19 related	Associate	37896870
Pemphigoid Bullous	Associate	36685490
Perinatal Death	Associate	35640456
Persistent Infection	Associate	32423094
Personality Disorders	Associate	36969980
Pigmentary Disorder Reticulate with Systemic Manifestations	Associate	25359286
Pituitary Diseases	Associate	33786714
Placenta Diseases	Associate	33351086, 36628848
Plaque Atherosclerotic	Inhibit	20798044
Pneumonia	Associate	32639084, 33388749, 35703556
Polycystic Ovary Syndrome	Inhibit	35477803
Post Acute COVID 19 Syndrome	Inhibit	34200325
Post Acute COVID 19 Syndrome	Associate	34934117, 36360172, 38069039, 40076720
Post Acute COVID 19 Syndrome	Stimulate	37497655
Pre Eclampsia	Associate	32853537, 34996340, 36088594, 36419766, 36881072
Premature Birth	Associate	32853537, 34359894
Prostatic Neoplasms	Associate	37108754
Pterygium	Associate	34826419
Pulmonary Arterial Hypertension	Associate	31430320, 36038007, 37404175
Pulmonary Disease Chronic Obstructive	Associate	32269089, 32428380, 32496587, 32675207, 33174446, 33978304, 34157565, 34671211, 35011584, 35747501
Pulmonary Disease Chronic Obstructive	Stimulate	34051791
Pulmonary Disease Chronic Obstructive	Inhibit	35046647
Pulmonary Fibrosis	Associate	33978304
Raynaud Disease	Associate	37404175
Rectal Neoplasms	Stimulate	32366279
Rectal Neoplasms	Associate	34257580
Renal cell carcinoma 1	Associate	39259045
Renal Insufficiency Chronic	Associate	28186543, 33125431
Renal Insufficiency Chronic	Stimulate	29561187
Reproductive Tract Infections	Associate	32594644
Reproductive Tract Infections	Stimulate	34204705
Respiration Disorders	Associate	32970391
Respiratory Distress Syndrome	Associate	32840758, 33073716, 33249290, 33419885, 33958627, 34628788, 34646263, 35305693, 36251689, 36877757
Respiratory Distress Syndrome	Stimulate	34449302
Respiratory Insufficiency	Associate	33397514
Respiratory Tract Diseases	Associate	32882331
Respiratory Tract Infections	Stimulate	33278618
Respiratory Tract Infections	Associate	34714440, 37442134
Rhinitis Allergic	Inhibit	32422146
Scleroderma Systemic	Associate	37404175
Severe Acute Respiratory Syndrome	Associate	14670965, 14754895, 15141377, 15983030, 16282461, 17031779, 18070603, 19333547, 19411314, 21435673, 32303424, 32423094, 32423095, 32582222, 32633594, 32729248, 32841599, 33032170, 33174669, 33253796, 33879756, 33913101, 34198852, 35661534, 35778545, 35862802, 35932890, 35967361, 36056420
Signs and Symptoms	Associate	24275226, 34847569
Signs and Symptoms Digestive	Associate	32311451, 33059040
Signs and Symptoms Respiratory	Associate	33506945
Skin Diseases	Associate	24203630
Small Cell Lung Carcinoma	Associate	35040271
Smoke Inhalation Injury	Stimulate	32303424, 32455539, 36258658
Smoke Inhalation Injury	Inhibit	34073591
Smoke Inhalation Injury	Associate	35032553
Soft Tissue Injuries	Associate	33837392, 35111161, 35260304, 35728978
Squamous Cell Carcinoma of Head and Neck	Associate	32673940, 34719202
Status Asthmaticus	Associate	34233672, 34503323, 35226423, 37506151
Status Asthmaticus	Stimulate	35111161
Stomach Neoplasms	Stimulate	32366279
Stomach Neoplasms	Associate	33231569
Stroke	Associate	27500554
Substance Related Disorders	Associate	35967361
Thromboinflammation	Associate	33042157
Thrombophilia	Associate	34471195, 35938548, 38497867
Thrombosis	Associate	33032170, 33836338, 35938548, 38497867
Thyroiditis Subacute	Associate	33025553
Trauma Nervous System	Associate	33181224
Tyrosine Kinase 2 Deficiency	Associate	34274504
Urinary Bladder Neoplasms	Associate	33231569
Vascular Diseases	Associate	32463098, 33032170, 34509916, 36334414
Vascular Remodeling	Associate	33469663
Vascular System Injuries	Associate	32777054, 34073591
Ventricular Remodeling	Associate	25869724, 38138974
Virus Diseases	Associate	32303424, 32348692, 32482249, 32501810, 32531372, 32558150, 32593740, 33002032, 33046696, 33401657, 33819740, 33853637, 33969332, 34224022, 34346317, 34435953, 34674770, 35181735, 35261286, 35286852, 35632769, 35634778, 35688710, 35709328, 35891433, 36567123, 36851546, 36853707, 37326579, 37376581, 38203386, 38310477
Weight Loss	Associate	33065163, 34903696
Weight Loss	Inhibit	36973648
Zinc Deficiency Neonatal due to Low Breast Milk Zinc	Inhibit	34479494