RB1 (RB transcriptional corepressor 1)

Gene

• Entrez ID: 5925
• Gene name: RB transcriptional corepressor 1
• Gene symbol: RB1
• Synonyms (NCBI Gene): OSRC, PPP1R130, RB, p105-Rb, p110-RB1, pRb, pp110
• Chromosome: 13
• Chromosome location: 13q14.2
• Summary: The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophospho

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs3092895	A>G,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant, missense variant
rs121913295	G>T	Likely-pathogenic	Missense variant, coding sequence variant
rs121913296	G>T	Likely-pathogenic, pathogenic	Stop gained, coding sequence variant
rs121913297	G>A,T	Uncertain-significance, likely-pathogenic, pathogenic	Stop gained, missense variant, coding sequence variant
rs121913298	T>A	Likely-pathogenic	Stop gained, coding sequence variant
rs121913305	C>T	Pathogenic	Stop gained, coding sequence variant
rs137853292	C>T	Pathogenic	Missense variant, coding sequence variant
rs137853293	C>T	Pathogenic	Stop gained, coding sequence variant
rs137853294	C>T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs137853295	G>T	Pathogenic	Stop gained, coding sequence variant
rs137853296	T>C	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs137853297	T>A	Pathogenic	Stop gained, coding sequence variant
rs142509759	C>A,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant, synonymous variant
rs143685082	A>G	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Intron variant
rs145310579	T>C	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant
rs373601944	G>A,T	Not-provided, conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs376886420	A>C,G	Likely-benign, uncertain-significance, likely-pathogenic	Intron variant
rs398123333	GAATGAGTATGAA>CAC	Pathogenic	Coding sequence variant, frameshift variant
rs483352689	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs483352690	G>A,C	Conflicting-interpretations-of-pathogenicity, pathogenic	Coding sequence variant, missense variant
rs587776779	G>-	Pathogenic	Splice donor variant, coding sequence variant
rs587776780	T>C	Pathogenic	Splice donor variant
rs587776781	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs587776784	AATCTGCTTG>-	Pathogenic	Frameshift variant, coding sequence variant
rs587776785	TTTATAAAA>-	Pathogenic	Inframe indel, stop gained, coding sequence variant
rs587776786	G>A	Pathogenic	Splice acceptor variant
rs587776787	G>A,T	Pathogenic	Synonymous variant, missense variant, coding sequence variant
rs587776789	G>A,T	Pathogenic	Splice donor variant
rs587776791	A>G	Pathogenic	Intron variant
rs587778824	->TA	Pathogenic	Genic upstream transcript variant, stop gained, coding sequence variant
rs587778825	GT>-	Pathogenic	Frameshift variant, coding sequence variant
rs587778826	G>A,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs587778827	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs587778833	C>T	Pathogenic	Stop gained, coding sequence variant
rs587778835	C>T	Pathogenic	Missense variant, coding sequence variant
rs587778836	->TGAT	Pathogenic	Frameshift variant, coding sequence variant
rs587778837	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs587778838	G>A	Pathogenic	Splice acceptor variant
rs587778839	T>C	Pathogenic	Splice donor variant
rs587778840	A>-	Pathogenic	Genic upstream transcript variant, frameshift variant, coding sequence variant
rs587778841	TGCT>-	Pathogenic	Frameshift variant, coding sequence variant
rs587778842	C>T	Pathogenic	Stop gained, coding sequence variant
rs587778849	A>T	Pathogenic	Stop gained, coding sequence variant
rs587778850	G>A,T	Pathogenic	Splice donor variant
rs587778851	->C	Pathogenic	Frameshift variant, coding sequence variant
rs587778854	->T	Pathogenic	Frameshift variant, coding sequence variant
rs587778858	G>T	Pathogenic	Stop gained, coding sequence variant
rs587778859	G>A	Pathogenic	Missense variant, coding sequence variant
rs587778860	G>A,C	Likely-pathogenic, pathogenic	Splice acceptor variant
rs587778861	T>A,C	Pathogenic	Synonymous variant, stop gained, coding sequence variant
rs587778862	AG>-	Pathogenic	Genic upstream transcript variant, frameshift variant, coding sequence variant
rs587778864	C>T	Pathogenic	Stop gained, coding sequence variant
rs587778865	T>A	Pathogenic	Stop gained, coding sequence variant
rs587778866	A>G	Pathogenic	Missense variant, coding sequence variant
rs587778867	A>T	Pathogenic	Splice acceptor variant
rs587778868	G>T	Pathogenic	Stop gained, coding sequence variant
rs587778870	C>G,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs587778871	G>A,C	Likely-pathogenic, pathogenic	Intron variant
rs587781257	T>-	Pathogenic	Frameshift variant, coding sequence variant
rs748094394	G>A,C	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant
rs750136284	T>A,C	Likely-pathogenic, likely-benign	Synonymous variant, stop gained, coding sequence variant
rs764754259	G>A,C	Pathogenic	Splice donor variant
rs768305224	C>A,T	Pathogenic	Stop gained, coding sequence variant, missense variant
rs774744607	T>A,C,G	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs794727199	G>A	Pathogenic	Splice acceptor variant
rs794727372	C>A,T	Pathogenic, likely-benign	Coding sequence variant, synonymous variant, stop gained
rs794727481	G>A	Pathogenic	Coding sequence variant, stop gained
rs878853949	C>T	Pathogenic	Coding sequence variant, stop gained
rs886042249	G>A	Pathogenic, uncertain-significance	Intron variant
rs886042357	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs886042935	C>T	Pathogenic	Coding sequence variant, stop gained
rs886043313	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1060503067	G>T	Pathogenic	Coding sequence variant, stop gained
rs1060503075	CCTC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1060503088	T>G	Pathogenic	Intron variant
rs1064795296	T>-	Pathogenic	Splice donor variant
rs1064795438	AGATG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1131690842	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690843	G>A,C	Likely-pathogenic	Coding sequence variant, missense variant
rs1131690844	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690847	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690849	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690857	A>G	Pathogenic	Coding sequence variant, missense variant
rs1131690858	GAGT>-	Pathogenic	Intron variant, splice donor variant
rs1131690862	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1131690863	C>T	Pathogenic	Coding sequence variant, stop gained
rs1131690864	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1131690865	C>T	Pathogenic	Coding sequence variant, stop gained
rs1131690866	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690867	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690868	TATATTTC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690871	C>-	Pathogenic	Coding sequence variant, stop gained
rs1131690874	G>T	Pathogenic	Coding sequence variant, stop gained
rs1131690878	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690880	G>T	Pathogenic	Splice donor variant
rs1131690881	G>A,T	Pathogenic, likely-pathogenic	Intron variant
rs1131690882	G>A,C	Pathogenic, likely-pathogenic	Splice donor variant
rs1131690885	TCTG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690887	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690890	TA>ATC	Pathogenic	Coding sequence variant, frameshift variant
rs1131690891	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1131690893	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690894	AATA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690895	->T	Likely-pathogenic	Splice donor variant
rs1131690896	GGCAT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690899	T>G	Pathogenic	Splice donor variant
rs1131690902	G>A	Pathogenic	Splice donor variant
rs1131690903	G>T	Pathogenic	Coding sequence variant, stop gained
rs1131690904	G>T	Pathogenic	Coding sequence variant, stop gained
rs1131690905	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690906	C>A,T	Uncertain-significance, pathogenic	Coding sequence variant, missense variant, stop gained
rs1131690907	G>A	Pathogenic	Genic upstream transcript variant, splice donor variant
rs1131690908	C>A,G	Pathogenic	Coding sequence variant, stop gained
rs1131690912	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690915	C>T	Pathogenic	Coding sequence variant, stop gained
rs1555282775	A>T	Pathogenic	Stop gained, coding sequence variant
rs1555282811	A>T	Pathogenic	Intron variant
rs1555283482	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555283670	->ATTAG	Pathogenic	Stop gained, coding sequence variant, inframe indel
rs1555284956	G>A,C	Pathogenic	Synonymous variant, coding sequence variant, missense variant
rs1555294600	->AA	Pathogenic	Coding sequence variant, frameshift variant
rs1555294626	AAGG>TTT	Pathogenic	Coding sequence variant, frameshift variant
rs1555294634	AGGTGTGTG>-	Pathogenic	Coding sequence variant, splice donor variant, intron variant
rs1555294636	T>C	Likely-pathogenic	Splice donor variant
rs1555295354	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1566186087	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1566186125	TA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1566186836	G>A	Pathogenic	Splice acceptor variant
rs1566186840	A>T	Pathogenic	Stop gained, coding sequence variant
rs1566186889	->TGAT	Pathogenic	Stop gained, coding sequence variant
rs1566187856	G>A	Likely-pathogenic	Splice donor variant
rs1566192530	AACAG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1566192557	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1566233014	->G	Pathogenic	Coding sequence variant, frameshift variant
rs1566233076	C>T	Pathogenic	Stop gained, coding sequence variant
rs1566234123	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1566235470	C>T	Pathogenic	Stop gained, coding sequence variant
rs1566235515	T>A,C	Likely-pathogenic, pathogenic	Splice donor variant
rs1566237098	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1566240909	CT>-	Pathogenic	Stop gained, coding sequence variant
rs1593414337	G>A	Likely-pathogenic	Genic upstream transcript variant, splice acceptor variant
rs1593434175	ATATT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1593438023	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1593443514	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1593445096	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1593445220	TAATATAG>-	Pathogenic	Stop gained, coding sequence variant, inframe indel
rs1593445246	G>T	Pathogenic	Stop gained, coding sequence variant
rs1593529868	A>G	Likely-pathogenic	Splice acceptor variant
rs1593532084	TTAT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1593532101	->C	Pathogenic	Splice donor variant
rs1593534586	CTCCGGCTAAATACACTTT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1593538130	A>G	Pathogenic	Splice acceptor variant
rs1593538155	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1593538175	ATTCAAAA>C	Pathogenic	Coding sequence variant, frameshift variant
rs1593538220	C>T	Pathogenic	Stop gained, coding sequence variant
rs1593539225	C>A,T	Pathogenic, uncertain-significance	Stop gained, coding sequence variant, missense variant
rs1593539366	C>G	Pathogenic	Stop gained, coding sequence variant
rs1593539386	->GCCCTTACAAGTTTCCTAGTTC	Pathogenic	Stop gained, inframe insertion, coding sequence variant
rs1593539435	GGAACATCTA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1593539493	C>A	Pathogenic	Stop gained, coding sequence variant
rs1593539538	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1593544647	GA>-	Pathogenic	Coding sequence variant, splice acceptor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001840	hsa-miR-106a-5p	Microarray	19175831
MIRT003587	hsa-miR-335-5p	Luciferase reporter assay, Western blot	20713524
MIRT003587	hsa-miR-335-5p	Luciferase reporter assay, Western blot	20713524
MIRT003425	hsa-miR-23b-3p	flow, Microarray	20133741
MIRT003213	hsa-miR-26a-5p	GFP reporter assay, Luciferase reporter assay, Western blot	20080666
MIRT001840	hsa-miR-106a-5p	immunohistochemistry, Microarray	19175831
MIRT004664	hsa-miR-106b-5p	immunohistochemistry, Microarray	19175831
MIRT004749	hsa-miR-675-5p	Luciferase reporter assay, qRT-PCR	19926638
MIRT001840	hsa-miR-106a-5p	Immunohistochemistry, Microarray, Western blot	20643754
MIRT001840	hsa-miR-106a-5p	and lung tumor samples"	16461460
MIRT005850	hsa-miR-17-5p	Luciferase reporter assay	21283765
MIRT005857	hsa-miR-20a-5p	Luciferase reporter assay	21283765
MIRT004664	hsa-miR-106b-5p	Luciferase reporter assay	21283765
MIRT001840	hsa-miR-106a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20889678
MIRT006435	hsa-miR-192-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21511813
MIRT006435	hsa-miR-192-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21511813
MIRT006503	hsa-miR-132-3p	Luciferase reporter assay, Western blot	21329664
MIRT006503	hsa-miR-132-3p	Luciferase reporter assay, Western blot	21329664
MIRT006504	hsa-miR-212-3p	Luciferase reporter assay, Western blot	21329664
MIRT006504	hsa-miR-212-3p	Luciferase reporter assay, Western blot	21329664
MIRT006435	hsa-miR-192-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	21511813
MIRT006503	hsa-miR-132-3p	Luciferase reporter assay, Western blot	21329664
MIRT006503	hsa-miR-132-3p	Luciferase reporter assay, Western blot	21329664
MIRT006504	hsa-miR-212-3p	Luciferase reporter assay, Western blot	21329664
MIRT006504	hsa-miR-212-3p	Luciferase reporter assay, Western blot	21329664
MIRT003587	hsa-miR-335-5p	qRT-PCR, Western blot	22886530
MIRT004664	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21819631
MIRT003213	hsa-miR-26a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23108995
MIRT003213	hsa-miR-26a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23108995
MIRT020177	hsa-miR-130b-3p	Sequencing	20371350
MIRT004664	hsa-miR-106b-5p	Microarray	17242205
MIRT006503	hsa-miR-132-3p	Reporter assay;Western blot;qRT-PCR	21329664
MIRT024341	hsa-miR-215-5p	Microarray	19074876
MIRT006504	hsa-miR-212-3p	Reporter assay;Western blot;qRT-PCR	21329664
MIRT006435	hsa-miR-192-5p	Microarray	19074876
MIRT001840	hsa-miR-106a-5p	Reporter assay	16461460
MIRT028033	hsa-miR-93-5p	Sequencing	20371350
MIRT030738	hsa-miR-21-5p	Microarray	18591254
MIRT048653	hsa-miR-99a-5p	CLASH	23622248
MIRT048586	hsa-miR-100-5p	CLASH	23622248
MIRT045442	hsa-miR-149-5p	CLASH	23622248
MIRT001840	hsa-miR-106a-5p	Microarray	23807165
MIRT001840	hsa-miR-106a-5p	Immunohistochemistry, qRT-PCR	18996365
MIRT024341	hsa-miR-215-5p	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23981575
MIRT024341	hsa-miR-215-5p	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23981575
MIRT054352	hsa-miR-221-3p	Luciferase reporter assay, QRTPCR, Western blot	23630541
MIRT437472	hsa-miR-26b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24027266
MIRT437472	hsa-miR-26b-5p	Luciferase reporter assay, qRT-PCR, Western blot	24027266
MIRT006435	hsa-miR-192-5p	Luciferase reporter assay, qRT-PCR, Western blot	24012720
MIRT068755	hsa-miR-519a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24752803
MIRT068755	hsa-miR-519a-3p	qRT-PCR, Luciferase reporter assay, Western blot	24752803
MIRT068754	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT005850	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT004664	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT068752	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028033	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT001840	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT005857	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT068749	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT068755	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT068753	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT068751	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT068761	hsa-miR-4318	PAR-CLIP	21572407
MIRT068756	hsa-miR-892a	PAR-CLIP	21572407
MIRT554909	hsa-miR-1178-5p	PAR-CLIP	21572407
MIRT554908	hsa-miR-1182	PAR-CLIP	21572407
MIRT068763	hsa-miR-3614-5p	PAR-CLIP	21572407
MIRT554907	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT554906	hsa-miR-3909	PAR-CLIP	21572407
MIRT554905	hsa-miR-6852-3p	PAR-CLIP	21572407
MIRT068760	hsa-miR-3152-3p	PAR-CLIP	21572407
MIRT554904	hsa-miR-1258	PAR-CLIP	21572407
MIRT068765	hsa-miR-4693-5p	PAR-CLIP	21572407
MIRT068762	hsa-miR-4325	PAR-CLIP	21572407
MIRT554903	hsa-miR-450b-3p	PAR-CLIP	21572407
MIRT554902	hsa-miR-769-3p	PAR-CLIP	21572407
MIRT554901	hsa-miR-6728-5p	PAR-CLIP	21572407
MIRT554900	hsa-miR-5089-5p	PAR-CLIP	21572407
MIRT068766	hsa-miR-6513-5p	PAR-CLIP	21572407
MIRT731073	hsa-miR-141-3p	5.0	25241899
MIRT731073	hsa-miR-141-3p	5.0	25241899
MIRT731073	hsa-miR-141-3p	5.0	25241899
MIRT731073	hsa-miR-141-3p	5.0	25241899
MIRT731073	hsa-miR-141-3p	5.0	25241899
MIRT731073	hsa-miR-141-3p	5.0	25241899
MIRT004664	hsa-miR-106b-5p	Luciferase reporter assay, Microarray, Western blot	24292682
MIRT004664	hsa-miR-106b-5p	Luciferase reporter assay, Microarray, Western blot	24292682
MIRT006503	hsa-miR-132-3p	Microarray, RNA-seq	31426562
MIRT735221	hsa-miR-181a-3p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), qRT-PCR, Immunocytochemistry (ICC), ELISA	32591511
MIRT068749	hsa-miR-20b-5p	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization	32622332
MIRT068754	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT005850	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT004664	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT068752	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028033	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT001840	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT005857	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT068749	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT068755	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT068753	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT068751	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT068761	hsa-miR-4318	PAR-CLIP	21572407
MIRT068756	hsa-miR-892a	PAR-CLIP	21572407
MIRT554909	hsa-miR-1178-5p	PAR-CLIP	21572407
MIRT554908	hsa-miR-1182	PAR-CLIP	21572407
MIRT068763	hsa-miR-3614-5p	PAR-CLIP	21572407
MIRT554907	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT554906	hsa-miR-3909	PAR-CLIP	21572407
MIRT554905	hsa-miR-6852-3p	PAR-CLIP	21572407
MIRT068760	hsa-miR-3152-3p	PAR-CLIP	21572407
MIRT554904	hsa-miR-1258	PAR-CLIP	21572407
MIRT068765	hsa-miR-4693-5p	PAR-CLIP	21572407
MIRT068762	hsa-miR-4325	PAR-CLIP	21572407
MIRT554903	hsa-miR-450b-3p	PAR-CLIP	21572407
MIRT554902	hsa-miR-769-3p	PAR-CLIP	21572407
MIRT554901	hsa-miR-6728-5p	PAR-CLIP	21572407
MIRT554900	hsa-miR-5089-5p	PAR-CLIP	21572407
MIRT068766	hsa-miR-6513-5p	PAR-CLIP	21572407
MIRT006435	hsa-miR-192-5p	Luciferase reporter assay, Immunoprecipitaion (IP), CLIP-seq, Flow cytometry	35969010
MIRT1293359	hsa-miR-1245	CLIP-seq
MIRT1293360	hsa-miR-1257	CLIP-seq
MIRT1293361	hsa-miR-1273d	CLIP-seq
MIRT1293362	hsa-miR-128	CLIP-seq
MIRT1293363	hsa-miR-1283	CLIP-seq
MIRT1293364	hsa-miR-129-5p	CLIP-seq
MIRT1293365	hsa-miR-155	CLIP-seq
MIRT1293366	hsa-miR-221	CLIP-seq
MIRT1293367	hsa-miR-222	CLIP-seq
MIRT1293368	hsa-miR-298	CLIP-seq
MIRT1293369	hsa-miR-3119	CLIP-seq
MIRT1293370	hsa-miR-3128	CLIP-seq
MIRT1293371	hsa-miR-3146	CLIP-seq
MIRT1293372	hsa-miR-3177-5p	CLIP-seq
MIRT1293373	hsa-miR-3187-3p	CLIP-seq
MIRT1293374	hsa-miR-340	CLIP-seq
MIRT1293375	hsa-miR-365	CLIP-seq
MIRT1293376	hsa-miR-3678-3p	CLIP-seq
MIRT1293377	hsa-miR-3921	CLIP-seq
MIRT1293378	hsa-miR-3973	CLIP-seq
MIRT1293379	hsa-miR-4257	CLIP-seq
MIRT1293380	hsa-miR-4263	CLIP-seq
MIRT1293381	hsa-miR-4276	CLIP-seq
MIRT1293382	hsa-miR-4282	CLIP-seq
MIRT1293383	hsa-miR-4427	CLIP-seq
MIRT1293384	hsa-miR-4474-3p	CLIP-seq
MIRT1293385	hsa-miR-450b-5p	CLIP-seq
MIRT1293386	hsa-miR-4529-5p	CLIP-seq
MIRT1293387	hsa-miR-4653-5p	CLIP-seq
MIRT1293388	hsa-miR-4670-3p	CLIP-seq
MIRT1293389	hsa-miR-4672	CLIP-seq
MIRT1293390	hsa-miR-4677-3p	CLIP-seq
MIRT1293391	hsa-miR-4679	CLIP-seq
MIRT1293392	hsa-miR-4680-3p	CLIP-seq
MIRT1293393	hsa-miR-4699-5p	CLIP-seq
MIRT1293394	hsa-miR-4704-3p	CLIP-seq
MIRT1293395	hsa-miR-4720-5p	CLIP-seq
MIRT1293396	hsa-miR-4725-5p	CLIP-seq
MIRT1293397	hsa-miR-4735-5p	CLIP-seq
MIRT1293398	hsa-miR-4775	CLIP-seq
MIRT1293399	hsa-miR-4780	CLIP-seq
MIRT1293400	hsa-miR-4789-5p	CLIP-seq
MIRT1293401	hsa-miR-4790-3p	CLIP-seq
MIRT1293402	hsa-miR-4799-3p	CLIP-seq
MIRT1293403	hsa-miR-494	CLIP-seq
MIRT1293404	hsa-miR-499-3p	CLIP-seq
MIRT1293405	hsa-miR-499a-3p	CLIP-seq
MIRT1293406	hsa-miR-504	CLIP-seq
MIRT1293407	hsa-miR-507	CLIP-seq
MIRT1293408	hsa-miR-520a-5p	CLIP-seq
MIRT1293409	hsa-miR-525-5p	CLIP-seq
MIRT1293410	hsa-miR-548v	CLIP-seq
MIRT1293411	hsa-miR-557	CLIP-seq
MIRT1293412	hsa-miR-576-5p	CLIP-seq
MIRT1293413	hsa-miR-590-3p	CLIP-seq
MIRT1293414	hsa-miR-663b	CLIP-seq
MIRT1293415	hsa-miR-889	CLIP-seq
MIRT1552966	hsa-miR-3942-5p	CLIP-seq
MIRT1552967	hsa-miR-4422	CLIP-seq
MIRT1552968	hsa-miR-4703-5p	CLIP-seq
MIRT2087155	hsa-miR-1296	CLIP-seq
MIRT2087156	hsa-miR-1912	CLIP-seq
MIRT2087157	hsa-miR-323b-3p	CLIP-seq
MIRT2087158	hsa-miR-3908	CLIP-seq
MIRT1552966	hsa-miR-3942-5p	CLIP-seq
MIRT1293382	hsa-miR-4282	CLIP-seq
MIRT2087159	hsa-miR-4328	CLIP-seq
MIRT1552967	hsa-miR-4422	CLIP-seq
MIRT2087160	hsa-miR-4436a	CLIP-seq
MIRT2087161	hsa-miR-4512	CLIP-seq
MIRT1293390	hsa-miR-4677-3p	CLIP-seq
MIRT1293391	hsa-miR-4679	CLIP-seq
MIRT1552968	hsa-miR-4703-5p	CLIP-seq
MIRT2087162	hsa-miR-4766-3p	CLIP-seq
MIRT1293398	hsa-miR-4775	CLIP-seq
MIRT2087163	hsa-miR-4803	CLIP-seq
MIRT1293403	hsa-miR-494	CLIP-seq
MIRT1293408	hsa-miR-520a-5p	CLIP-seq
MIRT1293409	hsa-miR-525-5p	CLIP-seq
MIRT2087164	hsa-miR-550b	CLIP-seq
MIRT1293412	hsa-miR-576-5p	CLIP-seq
MIRT2087165	hsa-miR-582-5p	CLIP-seq
MIRT1293413	hsa-miR-590-3p	CLIP-seq
MIRT2087166	hsa-miR-711	CLIP-seq
MIRT2087167	hsa-miR-802	CLIP-seq
MIRT2311988	hsa-miR-1197	CLIP-seq
MIRT1293362	hsa-miR-128	CLIP-seq
MIRT2087155	hsa-miR-1296	CLIP-seq
MIRT2311989	hsa-miR-1297	CLIP-seq
MIRT2087156	hsa-miR-1912	CLIP-seq
MIRT2311990	hsa-miR-26a	CLIP-seq
MIRT2311991	hsa-miR-26b	CLIP-seq
MIRT2311992	hsa-miR-3120-3p	CLIP-seq
MIRT2311993	hsa-miR-3153	CLIP-seq
MIRT2311994	hsa-miR-3156-3p	CLIP-seq
MIRT1293372	hsa-miR-3177-5p	CLIP-seq
MIRT2311995	hsa-miR-3180-5p	CLIP-seq
MIRT2311996	hsa-miR-33a	CLIP-seq
MIRT2311997	hsa-miR-33b	CLIP-seq
MIRT2311998	hsa-miR-361-5p	CLIP-seq
MIRT2311999	hsa-miR-3919	CLIP-seq
MIRT1293377	hsa-miR-3921	CLIP-seq
MIRT1293379	hsa-miR-4257	CLIP-seq
MIRT1293382	hsa-miR-4282	CLIP-seq
MIRT2312000	hsa-miR-4301	CLIP-seq
MIRT1552967	hsa-miR-4422	CLIP-seq
MIRT2087160	hsa-miR-4436a	CLIP-seq
MIRT2312001	hsa-miR-4465	CLIP-seq
MIRT2087161	hsa-miR-4512	CLIP-seq
MIRT1293387	hsa-miR-4653-5p	CLIP-seq
MIRT2312002	hsa-miR-4662a-3p	CLIP-seq
MIRT1293388	hsa-miR-4670-3p	CLIP-seq
MIRT1293389	hsa-miR-4672	CLIP-seq
MIRT1293390	hsa-miR-4677-3p	CLIP-seq
MIRT1293391	hsa-miR-4679	CLIP-seq
MIRT1293394	hsa-miR-4704-3p	CLIP-seq
MIRT1293398	hsa-miR-4775	CLIP-seq
MIRT1293400	hsa-miR-4789-5p	CLIP-seq
MIRT1293403	hsa-miR-494	CLIP-seq
MIRT2312003	hsa-miR-498	CLIP-seq
MIRT1293408	hsa-miR-520a-5p	CLIP-seq
MIRT1293409	hsa-miR-525-5p	CLIP-seq
MIRT2312004	hsa-miR-532-3p	CLIP-seq
MIRT2087164	hsa-miR-550b	CLIP-seq
MIRT2312005	hsa-miR-570	CLIP-seq
MIRT1293413	hsa-miR-590-3p	CLIP-seq
MIRT2312006	hsa-miR-7	CLIP-seq
MIRT2087166	hsa-miR-711	CLIP-seq
MIRT1293399	hsa-miR-4780	CLIP-seq
MIRT2432464	hsa-miR-216a	CLIP-seq
MIRT2432465	hsa-miR-3200-5p	CLIP-seq
MIRT2432466	hsa-miR-3653	CLIP-seq
MIRT2432467	hsa-miR-3658	CLIP-seq
MIRT1293377	hsa-miR-3921	CLIP-seq
MIRT1293387	hsa-miR-4653-5p	CLIP-seq
MIRT1293388	hsa-miR-4670-3p	CLIP-seq
MIRT1293415	hsa-miR-889	CLIP-seq
MIRT2087155	hsa-miR-1296	CLIP-seq
MIRT2311994	hsa-miR-3156-3p	CLIP-seq
MIRT2312000	hsa-miR-4301	CLIP-seq
MIRT2087161	hsa-miR-4512	CLIP-seq
MIRT2087164	hsa-miR-550b	CLIP-seq
MIRT2087155	hsa-miR-1296	CLIP-seq
MIRT2311994	hsa-miR-3156-3p	CLIP-seq
MIRT2312000	hsa-miR-4301	CLIP-seq
MIRT2087161	hsa-miR-4512	CLIP-seq
MIRT2087164	hsa-miR-550b	CLIP-seq
MIRT2608358	hsa-miR-1269	CLIP-seq
MIRT2608359	hsa-miR-1269b	CLIP-seq
MIRT2608360	hsa-miR-127-5p	CLIP-seq
MIRT2608361	hsa-miR-1276	CLIP-seq
MIRT2608362	hsa-miR-129-3p	CLIP-seq
MIRT2087155	hsa-miR-1296	CLIP-seq
MIRT2311989	hsa-miR-1297	CLIP-seq
MIRT2608363	hsa-miR-1301	CLIP-seq
MIRT2087156	hsa-miR-1912	CLIP-seq
MIRT2608364	hsa-miR-192	CLIP-seq
MIRT2608365	hsa-miR-2054	CLIP-seq
MIRT2608366	hsa-miR-215	CLIP-seq
MIRT2311990	hsa-miR-26a	CLIP-seq
MIRT2311991	hsa-miR-26b	CLIP-seq
MIRT2608367	hsa-miR-297	CLIP-seq
MIRT1293368	hsa-miR-298	CLIP-seq
MIRT2311992	hsa-miR-3120-3p	CLIP-seq
MIRT2608368	hsa-miR-3125	CLIP-seq
MIRT2608369	hsa-miR-3130-3p	CLIP-seq
MIRT2608370	hsa-miR-3140-3p	CLIP-seq
MIRT2608371	hsa-miR-3143	CLIP-seq
MIRT2608372	hsa-miR-3145-3p	CLIP-seq
MIRT2608373	hsa-miR-3149	CLIP-seq
MIRT2311994	hsa-miR-3156-3p	CLIP-seq
MIRT2608374	hsa-miR-3160-3p	CLIP-seq
MIRT2608375	hsa-miR-3175	CLIP-seq
MIRT2608376	hsa-miR-3667-5p	CLIP-seq
MIRT2608377	hsa-miR-377	CLIP-seq
MIRT2608378	hsa-miR-3916	CLIP-seq
MIRT2608379	hsa-miR-4261	CLIP-seq
MIRT1293380	hsa-miR-4263	CLIP-seq
MIRT2312000	hsa-miR-4301	CLIP-seq
MIRT1552967	hsa-miR-4422	CLIP-seq
MIRT2608380	hsa-miR-4434	CLIP-seq
MIRT2312001	hsa-miR-4465	CLIP-seq
MIRT2608381	hsa-miR-4496	CLIP-seq
MIRT1293385	hsa-miR-450b-5p	CLIP-seq
MIRT2087161	hsa-miR-4512	CLIP-seq
MIRT2608382	hsa-miR-4516	CLIP-seq
MIRT2608383	hsa-miR-4520b-3p	CLIP-seq
MIRT2608384	hsa-miR-4529-3p	CLIP-seq
MIRT2608385	hsa-miR-4637	CLIP-seq
MIRT2608386	hsa-miR-4660	CLIP-seq
MIRT2312002	hsa-miR-4662a-3p	CLIP-seq
MIRT1293393	hsa-miR-4699-5p	CLIP-seq
MIRT1293396	hsa-miR-4725-5p	CLIP-seq
MIRT2608387	hsa-miR-4728-5p	CLIP-seq
MIRT2608388	hsa-miR-4731-3p	CLIP-seq
MIRT1293398	hsa-miR-4775	CLIP-seq
MIRT1293399	hsa-miR-4780	CLIP-seq
MIRT2608389	hsa-miR-4793-3p	CLIP-seq
MIRT2608390	hsa-miR-4801	CLIP-seq
MIRT2312003	hsa-miR-498	CLIP-seq
MIRT1293406	hsa-miR-504	CLIP-seq
MIRT2608391	hsa-miR-5047	CLIP-seq
MIRT1293407	hsa-miR-507	CLIP-seq
MIRT2608392	hsa-miR-543	CLIP-seq
MIRT2608393	hsa-miR-548ac	CLIP-seq
MIRT2608394	hsa-miR-548ae	CLIP-seq
MIRT2608395	hsa-miR-548aj	CLIP-seq
MIRT2608396	hsa-miR-548am	CLIP-seq
MIRT2608397	hsa-miR-548d-3p	CLIP-seq
MIRT2608398	hsa-miR-548p	CLIP-seq
MIRT2608399	hsa-miR-548x	CLIP-seq
MIRT2608400	hsa-miR-548z	CLIP-seq
MIRT2087164	hsa-miR-550b	CLIP-seq
MIRT1293411	hsa-miR-557	CLIP-seq
MIRT1293412	hsa-miR-576-5p	CLIP-seq
MIRT1293413	hsa-miR-590-3p	CLIP-seq
MIRT2608401	hsa-miR-664	CLIP-seq
MIRT2312006	hsa-miR-7	CLIP-seq
MIRT2608358	hsa-miR-1269	CLIP-seq
MIRT2608359	hsa-miR-1269b	CLIP-seq
MIRT2689374	hsa-miR-1272	CLIP-seq
MIRT2608360	hsa-miR-127-5p	CLIP-seq
MIRT2689375	hsa-miR-1289	CLIP-seq
MIRT2608362	hsa-miR-129-3p	CLIP-seq
MIRT2087155	hsa-miR-1296	CLIP-seq
MIRT2311989	hsa-miR-1297	CLIP-seq
MIRT2608363	hsa-miR-1301	CLIP-seq
MIRT2087156	hsa-miR-1912	CLIP-seq
MIRT2608364	hsa-miR-192	CLIP-seq
MIRT2689376	hsa-miR-203	CLIP-seq
MIRT2608365	hsa-miR-2054	CLIP-seq
MIRT2608366	hsa-miR-215	CLIP-seq
MIRT2311990	hsa-miR-26a	CLIP-seq
MIRT2311991	hsa-miR-26b	CLIP-seq
MIRT2608367	hsa-miR-297	CLIP-seq
MIRT1293368	hsa-miR-298	CLIP-seq
MIRT2608369	hsa-miR-3130-3p	CLIP-seq
MIRT2608371	hsa-miR-3143	CLIP-seq
MIRT2608372	hsa-miR-3145-3p	CLIP-seq
MIRT2608373	hsa-miR-3149	CLIP-seq
MIRT2311994	hsa-miR-3156-3p	CLIP-seq
MIRT2608375	hsa-miR-3175	CLIP-seq
MIRT2689377	hsa-miR-3198	CLIP-seq
MIRT2608376	hsa-miR-3667-5p	CLIP-seq
MIRT2608377	hsa-miR-377	CLIP-seq
MIRT1293380	hsa-miR-4263	CLIP-seq
MIRT2689378	hsa-miR-4294	CLIP-seq
MIRT2312000	hsa-miR-4301	CLIP-seq
MIRT2689379	hsa-miR-4309	CLIP-seq
MIRT2608380	hsa-miR-4434	CLIP-seq
MIRT2312001	hsa-miR-4465	CLIP-seq
MIRT2087161	hsa-miR-4512	CLIP-seq
MIRT2608382	hsa-miR-4516	CLIP-seq
MIRT2608383	hsa-miR-4520b-3p	CLIP-seq
MIRT2608384	hsa-miR-4529-3p	CLIP-seq
MIRT2608385	hsa-miR-4637	CLIP-seq
MIRT2608386	hsa-miR-4660	CLIP-seq
MIRT2312002	hsa-miR-4662a-3p	CLIP-seq
MIRT2689380	hsa-miR-4694-3p	CLIP-seq
MIRT1293396	hsa-miR-4725-5p	CLIP-seq
MIRT2608387	hsa-miR-4728-5p	CLIP-seq
MIRT2608388	hsa-miR-4731-3p	CLIP-seq
MIRT1293398	hsa-miR-4775	CLIP-seq
MIRT1293399	hsa-miR-4780	CLIP-seq
MIRT2608389	hsa-miR-4793-3p	CLIP-seq
MIRT2608390	hsa-miR-4801	CLIP-seq
MIRT2312003	hsa-miR-498	CLIP-seq
MIRT1293406	hsa-miR-504	CLIP-seq
MIRT2608391	hsa-miR-5047	CLIP-seq
MIRT2608392	hsa-miR-543	CLIP-seq
MIRT2608393	hsa-miR-548ac	CLIP-seq
MIRT2608394	hsa-miR-548ae	CLIP-seq
MIRT2608395	hsa-miR-548aj	CLIP-seq
MIRT2608396	hsa-miR-548am	CLIP-seq
MIRT2608397	hsa-miR-548d-3p	CLIP-seq
MIRT2608398	hsa-miR-548p	CLIP-seq
MIRT2608399	hsa-miR-548x	CLIP-seq
MIRT2608400	hsa-miR-548z	CLIP-seq
MIRT2087164	hsa-miR-550b	CLIP-seq
MIRT1293412	hsa-miR-576-5p	CLIP-seq
MIRT1293413	hsa-miR-590-3p	CLIP-seq
MIRT2608401	hsa-miR-664	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BDP1	Unknown	12734418
CTNNB1	Repression	16628468
DNMT1	Repression	17934516
E2F1	Activation	8264596
KAT2B	Activation	19525977
PAX5	Unknown	10197586
RB1	Repression	8264596
RB1CC1	Activation	12095676
RB1CC1	Unknown	14533007;20614030
TP53	Unknown	8119988
UHRF1	Activation	16007129

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	19149898
GO:0000785	Component	Chromatin	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001894	Process	Tissue homeostasis	IEA
GO:0002062	Process	Chondrocyte differentiation	IEA
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003714	Function	Transcription corepressor activity	TAS	19149898
GO:0005515	Function	Protein binding	IPI	1331501, 1870208, 2138977, 2153075, 2162480, 2189724, 7503932, 7592647, 7651420, 7664264, 7791904, 7890747, 7923370, 8756624, 9067421, 9395244, 9448006, 9468139, 9468140, 9608663, 9697699, 9858607, 9881977, 10613832, 10779361, 10783144, 10944455, 11073990, 11268000, 11571652, 12037672
GO:0005634	Component	Nucleus	IDA	1531329, 17540172
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	2730637
GO:0005634	Component	Nucleus	TAS	3657987
GO:0005654	Component	Nucleoplasm	IDA	8245034
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	TAS	19149898
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	1531329
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	2730637
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006469	Process	Negative regulation of protein kinase activity	IPI	9858607
GO:0006915	Process	Apoptotic process	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007265	Process	Ras protein signal transduction	IEP	9054499
GO:0007283	Process	Spermatogenesis	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	20551165
GO:0008024	Component	Cyclin/CDK positive transcription elongation factor complex	IDA	12037672
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	25100735
GO:0014009	Process	Glial cell proliferation	IEA
GO:0016514	Component	SWI/SNF complex	TAS	19149898
GO:0016605	Component	PML body	IDA	9448006
GO:0019899	Function	Enzyme binding	IEA
GO:0019900	Function	Kinase binding	IDA	16286473
GO:0030154	Process	Cell differentiation	IBA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030308	Process	Negative regulation of cell growth	ISS
GO:0031134	Process	Sister chromatid biorientation	IMP	20551165
GO:0031175	Process	Neuron projection development	IBA
GO:0031175	Process	Neuron projection development	IEA
GO:0031507	Process	Heterochromatin formation	IDA	17540172
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	10944455
GO:0032502	Process	Developmental process	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0034088	Process	Maintenance of mitotic sister chromatid cohesion	IMP	20551165
GO:0034349	Process	Glial cell apoptotic process	IEA
GO:0035189	Component	Rb-E2F complex	IBA
GO:0035189	Component	Rb-E2F complex	IDA	8245034
GO:0035189	Component	Rb-E2F complex	IEA
GO:0035189	Component	Rb-E2F complex	IPI	16360038
GO:0035189	Component	Rb-E2F complex	ISS
GO:0035189	Component	Rb-E2F complex	TAS	19149898
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0042551	Process	Neuron maturation	IEA
GO:0042802	Function	Identical protein binding	IPI	8288605, 16360038
GO:0043353	Process	Enucleate erythrocyte differentiation	IEA
GO:0043550	Process	Regulation of lipid kinase activity	IDA	16286473
GO:0045445	Process	Myoblast differentiation	IMP	15541338
GO:0045651	Process	Positive regulation of macrophage differentiation	IEA
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045786	Process	Negative regulation of cell cycle	ISS	24027266
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IMP	20551165
GO:0045879	Process	Negative regulation of smoothened signaling pathway	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	10783144, 12065415, 19223331
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	17540172
GO:0045892	Process	Negative regulation of DNA-templated transcription	TAS	19149898
GO:0045930	Process	Negative regulation of mitotic cell cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048565	Process	Digestive tract development	IEA
GO:0048667	Process	Cell morphogenesis involved in neuron differentiation	IBA
GO:0048667	Process	Cell morphogenesis involved in neuron differentiation	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051219	Function	Phosphoprotein binding	IPI	16360038
GO:0051276	Process	Chromosome organization	IMP	20551165
GO:0051301	Process	Cell division	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	TAS	19149898
GO:0060090	Function	Molecular adaptor activity	EXP	16360038
GO:0060253	Process	Negative regulation of glial cell proliferation	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061676	Function	Importin-alpha family protein binding	IPI	12695505
GO:0061793	Component	Chromatin lock complex	IPI	17540172
GO:0071459	Process	Protein localization to chromosome, centromeric region	IMP	20551165
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0090230	Process	Regulation of centromere complex assembly	TAS	20551165
GO:0097284	Process	Hepatocyte apoptotic process	IEA
GO:0097718	Function	Disordered domain specific binding	IPI	8245034
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	19417128
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	19223331
GO:1903055	Process	Positive regulation of extracellular matrix organization	IEA
GO:1903055	Process	Positive regulation of extracellular matrix organization	ISS
GO:1903944	Process	Negative regulation of hepatocyte apoptotic process	IEA
GO:1904028	Process	Positive regulation of collagen fibril organization	IEA
GO:1904028	Process	Positive regulation of collagen fibril organization	ISS
GO:1904761	Process	Negative regulation of myofibroblast differentiation	IEA
GO:1904761	Process	Negative regulation of myofibroblast differentiation	ISS
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IEA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IBA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IEA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	TAS	19149898
GO:2000679	Process	Positive regulation of transcription regulatory region DNA binding	IDA	25100735
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	ISS	24027266

Other IDs

• MIM: 614041
• HGNC: 9884
• e!Ensembl: ENSG00000139687

Protein

• UniProt ID: P06400
• Protein name: Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110)
• Protein function: Tumor suppressor that is a key regulator of the G1/S transition of the cell cycle (PubMed:10499802). The hypophosphorylated form binds transcription regulators of the E2F family, preventing transcription of E2F-responsive genes (PubMed:10499802)
• PDB: 1AD6, 1GH6, 1GUX, 1H25, 1N4M, 1O9K, 1PJM, 2AZE, 2QDJ, 2R7G, 3N5U, 3POM, 4CRI, 4ELJ, 4ELL, 9DGK, 9DHC, 9DHF, 9DHU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11934	DUF3452	109 → 228	Domain of unknown function (DUF3452)	Family
  PF01858	RB_A	373 → 573	Retinoblastoma-associated protein A domain	Domain
  PF01857	RB_B	646 → 765	Retinoblastoma-associated protein B domain	Domain
  PF08934	Rb_C	768 → 925	Rb C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the retina. Expressed in foreskin keratinocytes (at protein level) (PubMed:20940255). {ECO:0000269|PubMed:20940255}.
• Sequence:

  MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL
  CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTEL
  QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS
  ISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYK
  TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
  NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS
  NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK
  DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
  IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG
  NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
  TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
  RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
  FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
  PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
  TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
  LAEMTSTRTRMQKQKMNDSMDTSNKEEK

• Sequence length: 928

Pathways

KEGG:

Endocrine resistance
Cell cycle
Cellular senescence
Cushing syndrome
Hepatitis C
Hepatitis B
Human cytomegalovirus infection
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Chemical carcinogenesis - receptor activation
Pancreatic cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

Inhibition of replication initiation of damaged DNA by RB1/E2F1
Condensation of Prophase Chromosomes
Formation of Senescence-Associated Heterochromatin Foci (SAHF)
Oncogene Induced Senescence
Phosphorylation of proteins involved in G1/S transition by active Cyclin E:Cdk2 complexes
Cyclin E associated events during G1/S transition
Cyclin D associated events in G1
Cyclin A:Cdk2-associated events at S phase entry

<

Associated diseases

Causal
Disease merge term	Disease name	dbSNP ID	References
Retinoblastoma	retinoblastoma	rs587776782, rs1555279195, rs1593411974, rs121913300, rs1566186840, rs587778866, rs1131690881, rs1593445096, rs587778861, rs1555282775, rs387906521, rs1952726441, rs121913302, rs1566186125, rs1060503067, rs1593538155, rs587778841, rs1566199059, rs587776791, rs1131690876, rs1949433098, rs794727199, rs1555284956, rs121913301, rs1131690852, rs1593438023, rs587778855, rs1566186889, rs587778871, rs1593445220, rs794727372, rs1461382798, rs137853294, rs1131690849, rs1952831606, rs587778832, rs1566186836, rs1060503075, rs1593538175, rs587778870, rs1566234123, rs398123331, rs1131690842, rs1949433358, rs794727481, rs1555286611, rs1555279210, rs1593443514, rs587778844, rs1566191596, rs587778867, rs1593445246, rs587778837, rs1555286695, rs137853295, rs1131690864, rs1952831740, rs121913303, rs1566197747, rs1060503079, rs1593538220, rs587778854, rs1566237098, rs483352690, rs1949360306, rs878853947, rs1555286236, rs1593538130, rs1131690907, rs1593453973, rs587778829, rs1566174065, rs1593454115, rs587778838, rs1555283482, rs587776787, rs1131690901, rs1948513922, rs587778863, rs1566240909, rs376886420, rs1555286707, rs1593539225, rs587778826, rs1566187856, rs587778864, rs1131690882, rs1949420231, rs1555294636, rs1131690843, rs1593539493, rs587778830, rs1276653645, rs587778859, rs1593456963, rs1555294626, rs121913304, rs1131690860, rs1948522792, rs587778857, rs1131690859, rs878853949, rs587776779, rs1060503074, rs1593539366, rs587778869, rs1566192530, rs121913305, rs1949432057, rs1555279212, rs121913297, rs1131690902, rs1593455621, rs587778845, rs1566192557, rs587778860, rs1593457065, rs587778850, rs1555282811, rs587776788, rs1131690892, rs1948522929, rs587778840, rs1952680837, rs886042357, rs587776780, rs1060503087, rs1593539435, rs886037649, rs1566194415, rs587778858, rs1131690866, rs1555286503, rs1555285429, rs1131690880, rs1593539386, rs587776783, rs1566194323, rs587778849, rs1593457070, rs587778851, rs1555286250, rs137853296, rs1131690846, rs1948533760, rs587778862, rs1593448449, rs3092891, rs9535023, rs1593539538, rs587778842, rs1566199125, rs1566233014, rs1131690906, rs587778835, rs1354030520, rs587776784, rs1131690895, rs1593414337, rs1566196458, rs886043247, rs1593457108, rs587778839, rs1555294600, rs1131690851, rs1948533963, rs587778824, rs1593529868, rs137853292, rs1064792974, rs1593544647, rs587778827, rs1566235470, rs1131690908, rs587778868, rs1555286568, rs587776785, rs768305224, rs1952054473, rs587778831, rs1258442224, rs1593412002, rs764754259, rs1593457156, rs587778825, rs1555286220, rs587776789, rs1131690884, rs1217977493, rs587781256, rs137853293, rs1060503077, rs1593532101, rs587778828, rs1566174074, rs587778833, rs2138344431, rs1555286573, rs587776786, rs1131690904, rs755704180, rs587778846, rs1566233076, rs121913298, rs1593532084, rs1555295354, rs137853297, rs1131690886, rs587781257, rs587776781, rs1566235515, rs587778843, rs1566186087, rs587778865, rs1131690858, rs1593434175, rs587778836, rs1555283670, rs387906520, rs1131690863, rs1952511865, rs587778847, rs1566174147, rs1060503088, rs1593534586, rs121913296, rs587776790, rs1131690909, rs1566235448, rs727504121	N/A
Hereditary Retinoblastoma	hereditary retinoblastoma	rs137853296, rs1131690858	N/A
Lung carcinoma	Small cell lung carcinoma	rs121913297	N/A
Lynch syndrome	Lynch syndrome 4	rs750136284, rs587776789	N/A
neoplasm	Neoplasm	rs1131690863, rs121913301, rs587778867, rs587778850, rs587776783, rs587778833, rs587778825, rs1217977493	N/A

Unknown
Disease merge term	Disease name	Evidence	References	Source
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS
hereditary cancer	Hereditary cancer	N/A	N/A	ClinVar
Kidney Disease	Chronic kidney disease	N/A	N/A	GWAS
Medulloblastoma	medulloblastoma	N/A	N/A	ClinVar
Melanoma	melanoma	N/A	N/A	GenCC
ovarian cancer	Ovarian cancer	N/A	N/A	ClinVar
retinal dystrophy	Retinal dystrophy	N/A	N/A	ClinVar

Associations from Text Mining
Disease Name	Relationship Type	References
13q deletion syndrome	Associate	34573300
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	23223137, 26655088, 36075957
Adenocarcinoma	Associate	32460015, 34627261, 34674268, 35016432, 36573306, 37628903, 37967200
Adenocarcinoma Mucinous	Associate	17649817
Adenocarcinoma of Lung	Associate	18948947, 21151896, 25758528, 26066407, 29525983, 31292388, 31959344, 32616892, 32931935, 35016432, 35367201, 36583000, 36810856, 37520249
Adenoma Pleomorphic	Associate	21196892, 23900873
Adrenocortical Adenoma	Associate	33564960
Adrenocortical Carcinoma	Associate	25078331, 25490274, 29581542, 33564960
Allan Herndon Dudley syndrome	Associate	26195723
Anaplasia	Associate	32139107
Aneuploidy	Associate	19052088, 1911187, 19883508, 20003272, 28723239, 32057913, 34303217
Angina Unstable	Associate	35437049
Angiomyolipoma	Associate	36308711
Anus Neoplasms	Associate	24048785
Aortic Valve Disease	Associate	23595191
Arthritis Rheumatoid	Associate	14730602, 30352835
Arthritis Rheumatoid	Inhibit	37506143
Astrocytoma	Associate	10079373, 12556968, 15367334, 15970925, 26317630, 31736278, 35945679
Ataxia	Associate	34130600
Ataxia Telangiectasia	Associate	32345961, 37345209
Atherosclerosis	Associate	36303246
Atresia of small intestine	Associate	39742876
Biliary Tract Diseases	Associate	40138743
Body Dysmorphic Disorders	Associate	22909775
Bone Marrow Diseases	Associate	33369444
Brain Diseases	Associate	34130600
Brain Neoplasms	Associate	17311305, 18575738, 22205104, 27556418, 32345147, 32373934, 37140883
Branchioma	Associate	37401932
Breast Neoplasms	Associate	10193322, 10193332, 11267940, 11506494, 11717311, 11976406, 12021276, 12838314, 14572667, 15220371, 16457699, 16685266, 16966377, 17047088, 17074804, 17456764, 18060053, 18202149, 18236071, 18431743, 18782450, 19147702, 19706513, 1986383, 19940364, 20594292, 20614030, 20823156, 21203526, 21253829, 21459801, 21756866, 21816898, 2294744, 23029355, 23197489, 23485561, 23887295, 24469035, 24621502, 24883302, 25014225, 25216078, 25220500, 26004085, 26339389, 26439695, 26527317, 2725521, 27336726, 27462784, 27634906, 27849562, 28027327, 28620137, 28990063, 29236940, 30410061, 30597041, 30642295, 31704974, 31781306, 32005108, 32242058, 32860163, 33067557, 33191115, 33213401, 33335078, 33854672, 34244855, 34525987, 35256595, 35590107, 35711885, 36269797, 36332363, 36915230, 37202799, 38403110, 7577475, 9018120, 9215124, 9388270, 9528753, 9990866
Breast Neoplasms	Inhibit	2217208
Breast Neoplasms Male	Associate	33964913
Burkitt Lymphoma	Associate	10360642, 10482541, 10702389, 19694314, 36719239
Calcinosis Cutis	Inhibit	21099103
Calcinosis Cutis	Associate	36308711
Carcinogenesis	Associate	11079730, 11369633, 11965548, 12657136, 12912919, 12940460, 1316611, 1352883, 14695761, 15927959, 1648218, 17461478, 18475256, 1911187, 21816898, 23803020, 23832541, 26465338, 26787232, 26925970, 27629734, 30575267, 30720065, 32521925, 34058265, 34315877, 3480530, 35412907, 36175480, 36857183, 9192669
Carcinogenesis	Inhibit	34851822
Carcinoid Tumor	Associate	26008974, 31085341, 33144445, 9033254
Carcinoma	Associate	26429873, 31467233
Carcinoma	Inhibit	28887603, 33980253
Carcinoma Adenosquamous	Associate	17649814
Carcinoma Basal Cell	Inhibit	18782450
Carcinoma Ductal	Associate	11267940, 35743985
Carcinoma Endometrioid	Associate	10682682, 12515910, 24684970
Carcinoma Hepatocellular	Associate	11531255, 1339101, 16254459, 17278226, 17907805, 18281783, 24254306, 26576645, 26823834, 27246981, 27849562, 28300839, 29085029, 30531861, 35581624, 35761036, 36634747, 37781033, 7640222, 8957064
Carcinoma Hepatocellular	Inhibit	24935581
Carcinoma in Situ	Inhibit	16402033
Carcinoma in Situ	Stimulate	40362654
Carcinoma Intraductal Noninfiltrating	Associate	21756866, 23197489
Carcinoma Large Cell	Associate	26960398, 28535939, 29535388, 31085341, 33144445, 35331190
Carcinoma Lobular	Stimulate	35743985
Carcinoma Merkel Cell	Associate	19551862, 24406863, 26238782, 26743471, 26981779, 27121059, 34480892, 34593967, 36075957, 36736454
Carcinoma Neuroendocrine	Associate	30627226, 33563892, 34245124, 34247193, 34326338, 34647903, 35016432, 35367201, 35596001, 36653904, 36807750, 37345605
Carcinoma Neuroendocrine	Stimulate	34401980
Carcinoma Non Small Cell Lung	Associate	10376986, 10574258, 10965496, 11474135, 24200043, 26647789, 26960398, 30773851, 31774910, 34396834, 35598205, 35747993, 35792876, 35815661, 36282125, 38057344, 38233864, 8052667, 9192978, 9846966
Carcinoma Ovarian Epithelial	Associate	11076658, 18431743, 26043844, 33676525
Carcinoma Pancreatic Ductal	Associate	15865092, 24293293, 30535494
Carcinoma Renal Cell	Associate	29353061, 34980126, 37515929, 37629167, 38043790, 38492778, 39336758
Carcinoma Small Cell	Associate	24323898, 26340530, 28535939, 28951314, 29763719, 31228622, 31959344, 32389660, 32649013, 33031101, 34145257, 35662501, 36082904, 37628903, 38057798, 8180008
Carcinoma Small Cell	Inhibit	28106103, 30918106
Carcinoma Squamous Cell	Associate	11267938, 11737469, 17461478, 24323028, 28177435, 30446465, 31829519, 31959344, 34480892, 36075957, 37821306, 39481992
Carcinoma Squamous Cell	Inhibit	28106103
Carcinoma Transitional Cell	Associate	15161057, 17311305
Carcinosarcoma	Associate	32209061
Cardiomyopathy infantile histiocytoid	Associate	40277780
Cell Transformation Neoplastic	Associate	23707559
Cell Transformation Viral	Associate	22529291
Chediak Higashi Syndrome	Associate	34130600
Cholangiocarcinoma	Associate	8957064
Choline Deficiency	Inhibit	15147518
Chondrosarcoma	Associate	11332612, 18624751
Chordoma	Associate	16078265
Chromosomal Instability	Associate	24613344, 39227622
Chromosome 12 12p trisomy	Inhibit	18702872
Chromosome 12 12p trisomy	Associate	9753065
Chromosome Aberrations	Inhibit	18702872
Chromosome Disorders	Associate	17201183, 19252413, 20003272, 36124964
Chromothripsis	Associate	27741277
Colitis Ulcerative	Associate	34733451
Colorectal Neoplasms	Associate	11106567, 11207048, 18794899, 1911187, 19125701, 22020530, 23059827, 27321817, 28675510, 32123008, 34476575, 36296971, 39742876, 7779716, 7947085, 9369933
Compassion Fatigue	Associate	25135958
Congenital Abnormalities	Associate	40138429
Congenital disorder of glycosylation type 1B	Associate	23197489
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	34130600
Constipation	Associate	21505449
COVID 19	Associate	34058265
Death	Inhibit	18236071
Death	Associate	21203526, 23462184
Dendritic Cell Sarcoma Follicular	Associate	28621320, 37994105
Desmoid disease hereditary	Associate	17077595
Diabetes Mellitus	Associate	33490239
Diabetes Mellitus Type 1	Associate	10504475
Diabetes Mellitus Type 2	Associate	37049846
Disease	Associate	11267940, 2380395
Down Syndrome	Associate	21538823
Drug Related Side Effects and Adverse Reactions	Associate	27600289
Dysmenorrhea	Associate	26006736
Dystonic Disorders	Associate	32139107
Edema	Associate	26337765
Endocrine System Diseases	Associate	29443735, 36332363
Endometrial Hyperplasia	Associate	25495249, 34162378
Endometrial Neoplasms	Associate	10682682, 12515910, 15589577, 17649817, 21760855, 21816898, 22295114, 24531693, 29264761, 30816518, 33464989, 34162378, 35717540, 39577664
Endometriosis	Associate	16009159, 16616093, 18048499, 25217304, 33464989
Endometriosis	Inhibit	27593876
Ependymoma	Associate	12556968
Epstein Barr Virus Infections	Associate	25550786
Esophageal atresia with or without tracheoesophageal fistula	Associate	27246981
Esophageal Neoplasms	Associate	11079730, 11315260, 17461478, 32058552, 32104700, 34663841, 8415648
Esophageal Squamous Cell Carcinoma	Associate	11079730, 11570573, 11599796, 17461478, 22938432, 29866946, 34663841
Esophagitis	Associate	17461478
Eye Diseases	Associate	34336010
Eye Neoplasms	Associate	18073428
Familial cylindromatosis	Associate	26336083
Fanconi Anemia	Associate	26928463
Farber Lipogranulomatosis	Associate	31085341
Fetal Growth Retardation	Associate	20008130
Fever	Associate	8950161
Fibroadenoma	Associate	33727697
Fibrolamellar hepatocellular carcinoma	Associate	28486549
Frontotemporal Dementia	Associate	34130600
Frontotemporal Lobar Degeneration	Associate	22623979
Gallbladder Neoplasms	Stimulate	33563892
Gallbladder Neoplasms	Associate	34798839
Gastro enteropancreatic neuroendocrine tumor	Associate	26684240, 34647903
Gastrointestinal Neoplasms	Associate	37345605
Gastrointestinal Stromal Tumors	Associate	31553483, 31570771, 31758409
GATA2 Deficiency	Associate	12925224
Gaucher Disease	Associate	34130600
Genetic Diseases Inborn	Associate	22874878, 28780672
Genomic Instability	Inhibit	18723266
Gerstmann Straussler Scheinker Disease	Associate	34130600
Gilbert Disease	Associate	27096027
Glioblastoma	Associate	10079373, 11204276, 12556968, 20406234, 22157621, 23468990, 23707559, 23864165, 26337765, 27344175, 27502248, 30151703, 30816530, 30861589, 31896544, 33876327, 34525976, 34952640, 35945679, 38351343, 8764092
Glioma	Associate	11278920, 21470325, 21663659, 24077277, 30816530, 32665022, 40355925, 8286200
Glycogen Storage Disease	Associate	34130600
Head and Neck Neoplasms	Associate	16948516, 27507850, 34635145
Hearing Loss Bilateral	Associate	34336010
Hearing Loss Unilateral	Associate	31997559
Heart Valve Diseases	Associate	23595191
Hemangioblastoma	Associate	26768750
Hemangioendothelioma	Associate	24433316
Hemangioendothelioma Epithelioid	Associate	31577358
Hepatitis B	Inhibit	18782450
Hepatitis B	Associate	26339389
Hepatoblastoma	Associate	24373183
Hepatoblastoma	Inhibit	24935581
Hepatolenticular Degeneration	Associate	8234264
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30394935
Histiocytoma Malignant Fibrous	Associate	17094467
HIV Infections	Associate	22701041
Hodgkin Disease	Associate	25550786
Humoral Hypercalcemia Of Malignancy	Associate	38040321
Huntington Disease	Associate	34130600
Hydrocephalus	Associate	23900873
Hyperaldosteronism	Associate	15136974
Hyperoxia	Associate	18948382
Hyperparathyroidism Primary	Associate	27760455
Hyperplasia	Associate	26537237
Hypoxia	Associate	14710850, 15377335, 31834445, 8763866, 9528826, 9862563
Hypoxia Brain	Associate	10471034, 15377335
Immunologic Deficiency Syndromes	Inhibit	25377796
Immunologic Deficiency Syndromes	Associate	33760207
Infections	Inhibit	10662629
Infections	Associate	1316611, 14730602, 36719239
Inflammation	Associate	18048499, 37506143
Inflammation	Inhibit	23835558, 32377712, 37049846
Inflammatory Breast Neoplasms	Associate	28271309
Insulin Resistance	Associate	23315497
Insulin Resistance	Inhibit	37049846
Intellectual Disability	Associate	31806026
Intestinal Diseases	Associate	14695761, 27629734
Intracranial Embolism	Associate	33755733
Intraocular Lymphoma	Associate	29579639, 36291051
Kidney Calculi	Associate	15161057
Kidney Diseases	Associate	10504475
Kidney Neoplasms	Associate	37310408
Laminopathies	Associate	17274801
Laron Syndrome	Associate	27336726
Laryngeal Neoplasms	Associate	19141402
Leber Congenital Amaurosis	Associate	30312872
Leigh Disease	Associate	35662501
Leiomyoma	Associate	12413982, 19499404, 25625804, 26006736, 28664937, 31313594, 34224241
Leiomyosarcoma	Stimulate	19077296
Leiomyosarcoma	Associate	2765366, 27882721, 29270859, 29321523, 29327710, 29662154, 32299819, 33115433, 33788262
Leiomyosarcoma	Inhibit	37491255
Leukemia	Associate	10477726, 15178346, 1993222, 2242427, 2404525, 24987858
Leukemia B Cell	Associate	18702872
Leukemia Biphenotypic Acute	Associate	23900870
Leukemia Lymphocytic Chronic B Cell	Associate	11529851, 15057823, 18702872, 1993222, 21890456, 26043844, 7655020, 8378351, 8781411, 9454769, 9599022
Leukemia Lymphocytic Chronic B Cell	Inhibit	12010815
Leukemia Lymphoid	Associate	8471770
Leukemia Megakaryoblastic Acute	Associate	21538823
Leukemia Myeloid	Associate	10210318
Leukemia Myeloid Acute	Inhibit	11698483
Leukemia Myeloid Acute	Associate	1683797, 21643017, 30926971, 8813093
Leukemia Plasma Cell	Associate	22529291
Leukemia Prolymphocytic T Cell	Associate	11529851, 9753065
Leukemia Promyelocytic Acute	Associate	34042274
Leukemia T Cell	Associate	11041200
Lichen Sclerosus et Atrophicus	Associate	11737469
Lipoblastoma	Inhibit	29976943
Lipoblastoma	Associate	37307874
Lipoma	Associate	15136974, 26945059
Liposarcoma	Associate	15933756, 35672466, 7479800
Liposarcoma Myxoid	Associate	34168281
Lung Diseases	Associate	40138743
Lung Neoplasms	Associate	19472407, 25219825, 26647789, 27873319, 30773851, 31228622, 31340547, 33407425, 34308964, 9192978
Lymphatic Metastasis	Associate	17384651, 35711885, 37520249
Lymphatic Metastasis	Stimulate	8950161
Lymphoma	Associate	11027429, 12556968, 1993222, 9136918
Lymphoma B Cell	Associate	10323217, 10360642, 32345961
Lymphoma Large B Cell Diffuse	Associate	21693768, 31327185
Lymphoma Large Cell Anaplastic	Stimulate	16614728
Lymphoma Mantle Cell	Associate	12683869, 17332242, 18984860, 19594747, 1993222, 24682267, 26022239, 28059098, 8623927
Lymphoma Non Hodgkin	Associate	10360642, 11027429, 11529851, 19383911, 26043844, 27049262, 33063942, 9136918
Lymphoma T Cell Cutaneous	Associate	16614728
Malformations of Cortical Development Group I	Associate	24809452
Malignant mesenchymal tumor	Associate	32889887, 3480530
Medulloblastoma	Associate	11577176, 12556968
Melanoma	Associate	10727462, 15803180, 16645588, 17218782, 17916908, 27776349, 28526299, 31980996, 8611425, 9862563
Melanoma	Inhibit	33670958
Melanoma Cutaneous Malignant	Associate	10732752
Metrorrhagia	Associate	26006736
Mixed Tumor Malignant	Associate	37285266
Mouth Diseases	Associate	34983823
Mouth Neoplasms	Associate	21781453, 26459309
Multiple Myeloma	Associate	10706856, 10979940, 11278272, 11529851, 19135901, 24987674, 26474569, 28234347, 32345147, 8822942, 9207463
Mycosis Fungoides	Inhibit	16614728
Mycosis Fungoides	Associate	18832135
Myelodysplastic Syndromes	Associate	10848828, 27741277
Myelodysplastic Syndromes	Inhibit	16213365
Myelolipoma	Associate	15136974
Myeloproliferative Disorders	Associate	18723266
Myoepithelioma	Associate	28390395
Myxoma	Associate	22011900
Nasopharyngeal Carcinoma	Associate	32013999, 32862607
Neoplasm Metastasis	Associate	11079730, 12556968, 15655836, 20664703, 27835695, 29615433, 30833416, 31525487, 31685261, 32013999, 32493230, 33122107, 34183353, 34499237, 34799997, 36800542, 37017806, 37232011, 37445641, 38300595, 39336758, 40362654
Neoplasm Metastasis	Inhibit	32657779, 39481992
Neoplasm Recurrence Local	Associate	34326338
Neoplasms	Associate	10323217, 10360642, 10376969, 10574258, 10702389, 10779361, 10804285, 10825186, 10965496, 11079730, 11106567, 11207046, 11294829, 11474135, 11520274, 11570573, 11737469, 12163359, 12414815, 12446718, 12515910, 12541220, 12556968, 12594215, 12598654, 12875971, 12940460, 1352883, 14633593, 14695761, 15057823, 15094066, 15136974, 15161057, 15569046, 15589577, 15970925, 16078265, 16126868, 16211008, 16402033, 16467168, 16623759, 1673287, 16908528, 16966377, 16999816, 17047088, 17094467, 17131485, 17242198, 17311305, 17332242, 1734717, 17359536, 17456764, 17609271, 17649814, 17702869, 17974914, 1826560, 18281783, 18292657, 18383818, 18403638, 18475256, 18498268, 18503160, 18768921, 18806226, 18843795, 18948598, 19109880, 19125701, 19183342, 19223331, 19472407, 19491728, 19653712, 19846973, 19924135, 20181942, 20228779, 20594292, 20706560, 20851996, 20948989, 21099103, 21196892, 21203526, 21205865, 21253829, 21498571, 21615945, 2168563, 22027510, 22157621, 2217208, 22205104, 22219649, 22285198, 22322860, 22333593, 22510613, 22644489, 22655796, 22702391, 2294744, 22960745, 23289484, 23498719, 23665203, 23722650, 23756868, 23792647, 2380395, 23826216, 23887295, 23897969, 23921636, 24265703, 24336157, 24377544, 24403251, 24509483, 24613344, 24703847, 24767714, 24814393, 24937285, 24987858, 25027401, 25291363, 25480786, 25490678, 25602518, 25608559, 25758528, 25818292, 25863124, 25961742, 25999316, 2601691, 26022453, 26032781, 26043844, 26117602, 26195723, 26283183, 26288838, 26317630, 26337765, 26400668, 26429873, 26439695, 26501111, 26524723, 26575023, 26580448, 26625196, 26647789, 26684240, 26743471, 26753011, 26802149, 26832993, 26918730, 26925970, 27016411, 27084275, 27093186, 27124644, 27126562, 27155049, 2725521, 27270441, 27318443, 27349517, 2740342, 27556634, 27634906, 27655641, 27694442, 27741277, 27873319, 28106103, 28106538, 28210099, 28211617, 28285684, 28390395, 28448802, 28486549, 28535939, 28731050, 28734796, 2876425, 28776571, 28783718, 28811362, 28880708, 29049475, 29180607, 29206995, 29233828, 29327710, 29379195, 29505425, 29570891, 29571084, 29581542, 29615433, 29662154, 29914080, 29915391, 2994066, 29946183, 29981927, 30189895, 30584916, 30625331, 30936196, 31010837, 31085341, 31228622, 31341961, 31409745, 31736278, 31874108, 31896544, 31916728, 31922567, 31937901, 31959344, 31997559, 32014051, 32075943, 32139107, 32222358, 32242058, 32404308, 32502182, 32692450, 32709847, 32799607, 32920960, 33067557, 33144445, 33262201, 33577785, 33619588, 33670958, 33717076, 33727697, 33794293, 33879103, 33980253, 34003213, 34128847, 34168052, 34171053, 34177933, 34281486, 34294873, 34315877, 34326338, 34342838, 34399719, 34399808, 34511132, 34552068, 34570090, 34661528, 34674268, 34725851, 34779821, 34799705, 34853070, 34980012, 34983823, 35235778, 35328764, 35331190, 35338084, 35412907, 35484982, 35581624, 35596192, 35711885, 35735060, 35788723, 35969010, 35972731, 36012688, 36082904, 36108240, 36165912, 36173648, 36291051, 36307835, 36308711, 36399634, 36528757, 36573306, 36735656, 36800542, 36805510, 36807750, 36810856, 36835213, 36849151, 37003878, 37017806, 37052520, 37183818, 37264960, 37345605, 37388735, 37445805, 37460928, 37461056, 37673211, 37725435, 37883365, 38040321, 38181741, 38222455, 39742876, 39778672, 40138429, 7526887, 7547254, 7577475, 7640222, 7655020, 7710951, 8052667, 8286200, 8343223, 8415648, 8471770, 9000603, 9032231, 9215124, 9215125, 9311732, 9371798, 9420334, 9422532, 9436977, 9652762, 9828785, 9846966, 9990866
Neoplasms	Inhibit	10880954, 10982822, 11287602, 11315260, 11529851, 11531255, 11577176, 12181248, 12391156, 12442903, 12482990, 12657136, 12769842, 12912919, 12947006, 14730602, 14742422, 15220371, 15367600, 15485814, 15525513, 15525642, 16351740, 16457699, 16461460, 1648218, 16510457, 16753023, 17008723, 17068154, 17218785, 17649817, 17912037, 18160432, 18458673, 18760195, 18782450, 18793406, 18832135, 18948947, 18984860, 19020549, 19052088, 1911187, 19135901, 19252413, 19305381, 19789346, 1993222, 19940364, 20073072, 20157537, 20196847, 20237089, 20577596, 20664703, 21151896, 21241471, 21454377, 21835799, 22006429, 22011900, 22315424, 22336108, 22366686, 22798430, 22811582, 22938432, 22962577, 23059827, 23161755, 23197489, 23223137, 23284001, 23315417, 23509792, 23941963, 24019070, 24019915, 24073846, 24168400, 24782314, 24809452, 24878818, 24910096, 24935581, 25136604, 25140305, 25219825, 25393105, 25447904, 25593300, 25615717, 25823924, 25911104, 26100274, 26131956, 26238782, 26396485, 26541895, 26551667, 26576645, 26598524, 27121059, 27321817, 27344175, 27507850, 27567532, 27645778, 28234347, 28300839, 28621320, 28668075, 28887603, 29074172, 29155755, 29202480, 29246572, 29261756, 29271997, 29353061, 29684207, 29689640, 29921694, 29996110, 30293995, 30312872, 30315623, 30385631, 30518749, 31236944, 31323018, 31619281, 31796516, 31806970, 32019859, 32123008, 32268247, 32277725, 32341031, 32460015, 32493230, 33023625, 33073644, 33144218, 33271982, 33608379, 34071532, 34109976, 34462330, 34479548, 36124964, 36130950, 36603130, 37307874, 37390276, 37401932, 37410378, 37708614, 37725511, 37917619, 38105358, 38200245, 38219954, 38417627, 38429210, 38552852, 39769018, 7673249, 7710955, 7761404, 7779716, 7860618, 7958856, 8159685, 8202487, 8380252, 8413249, 8623927, 8764048, 9463382, 9546379, 9675141
Neoplasms Basal Cell	Associate	33258708
Neoplasms Cystic Mucinous and Serous	Associate	19679296, 24336157, 26043110, 37511582
Neoplasms Germ Cell and Embryonal	Associate	25522918
Neoplasms Glandular and Epithelial	Associate	19679296, 24336157
Neoplasms Radiation Induced	Associate	36788076
Neoplasms Second Primary	Associate	35382685
Neoplasms Squamous Cell	Associate	15132777, 19924135, 25115387, 25684524, 33687433
Neoplastic Cells Circulating	Associate	33761970
Neoplastic Syndromes Hereditary	Associate	31568710, 33827469, 34171053
Nerve Degeneration	Associate	15741232
Nervous System Neoplasms	Associate	12556968
Neuroblastoma	Associate	18413728, 20577596, 23892435, 25377796, 31429199, 34893606, 36982482, 39217334
Neuroendocrine Tumors	Associate	23127113, 25273089, 28991877, 31587305, 32094488, 33144445, 33522043, 34627261, 35440132, 35609408, 36044718, 37725435, 9033254
Neuroendocrine Tumors	Inhibit	33031101
Neurofibrosarcoma	Associate	12556968, 18413802, 19414372, 34065204
Neuronal Ceroid Lipofuscinoses	Associate	34130600
Nevus Pigmented	Associate	17578512
Niemann Pick Disease Type A	Associate	34130600
Non Muscle Invasive Bladder Neoplasms	Associate	26238431, 32165095, 33388091, 33879103, 34177933, 34953602, 35073341, 40215668, 9436977
Obesity	Inhibit	23315497, 32377712
Obesity	Associate	37049846
Oligodendroglioma	Associate	25608559
Oral Submucous Fibrosis	Associate	38050610
Oropharyngeal Neoplasms	Associate	30189895
Osteosarcoma	Associate	10817503, 11152455, 11418138, 14679136, 14728297, 1673287, 20465837, 20851996, 22006429, 24703847, 24835790, 26787232, 27124644, 27352193, 2740342, 2898730, 29706636, 2994066, 31236944, 31568710, 35412907, 36849151, 7479800, 8703379, 9665476, 9671466
Osteosarcoma	Inhibit	9192669
Ovarian Diseases	Associate	18507046, 31792669, 31878927
Ovarian Diseases	Inhibit	27593876
Ovarian Neoplasms	Associate	11076658, 12149147, 15028555, 17047088, 17242700, 18431743, 18507046, 21278246, 21908773, 23176303, 23574718, 24336157, 25803614, 26577046, 28319064, 28734796, 29191971, 31060523, 31540229, 31709901, 32553118, 32877668, 34075060, 35735060, 36721777, 37511582
Pancreatic Neoplasms	Associate	21329664, 24293293, 28059098, 30535494
Pancreatitis	Associate	25273089, 40138743
Papilloma	Associate	1321820
Papillomavirus Infections	Inhibit	14633593, 25035383
Papillomavirus Infections	Associate	26032781, 30189895
Parkinson Disease	Associate	25182869, 34130600
Paroxysmal nonkinesigenic dyskinesia	Associate	36717865
Penile Neoplasms	Associate	28751665
Peritoneal Neoplasms	Associate	34476575
Peritonitis	Associate	31568710
Personality Disorders	Associate	36573306
Phyllodes Tumor	Associate	26832993, 31647027, 32504368, 33727697
Pinealoma	Associate	25022261, 31768671, 33619588
Pituitary Diseases	Associate	15136974
Pituitary Neoplasms	Associate	12940460
Polycystic Ovary Syndrome	Inhibit	25603724
Polydactyly	Associate	11167295
Polyomavirus Infections	Associate	25291363
Polyps	Associate	14584071
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	30874617
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10733508, 15034294, 20435627, 23900870, 2404525, 30874617
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	15724842, 1993222, 27036041
Primary Myelofibrosis	Associate	18723266
Prodromal Symptoms	Associate	20594292, 30872465
Propping Zerres syndrome	Associate	33144218
Prostate cancer familial	Associate	7761404
Prostate Cancer Hereditary 7	Associate	26546618, 35331214, 37877742
Prostate Cancer Hereditary 7	Inhibit	32341031
Prostatic Hyperplasia	Associate	7526887
Prostatic Neoplasms	Associate	17218785, 20948989, 21099103, 26195723, 26444865, 26520443, 26546618, 28059768, 29681457, 29921690, 30339521, 30458854, 30833416, 31134918, 31352849, 31525487, 31796516, 32019859, 32203070, 32460015, 32763409, 33115829, 33522043, 34168052, 34294873, 34462330, 34568716, 34889043, 35179959, 35304525, 35820087, 37183818, 37352376, 37725435, 37967200, 38429210, 9675141
Prostatic Neoplasms	Inhibit	29202480, 9813067
Prostatic Neoplasms Castration Resistant	Inhibit	29921690, 34568716
Prostatic Neoplasms Castration Resistant	Associate	30928160, 31010837, 31061129, 31796516, 31874108, 32091413, 32268276, 34103179, 34462330, 35121110, 35304525, 35725469, 37967200, 38429210
Prostatitis	Associate	11943705, 2217208, 7526887
Protein S Deficiency	Associate	9420334
Psoriasis	Associate	29115643
Psychomotor Disorders	Associate	22909775
Pterygium	Associate	33299863
Pulmonary Arterial Hypertension	Associate	15136974
Pulmonary Disease Chronic Obstructive	Associate	31829519
Pyruvate Carboxylase Deficiency Disease	Associate	32460015
Radiation Injuries	Associate	36849151
Respiratory Tract Infections	Associate	26278805, 36818471
Retinal Dysplasia	Associate	16402033, 17461478
Retinal Neoplasms	Associate	20577596, 24911651, 31404748, 9400934
Retinal Neoplasms	Inhibit	32502182
Retinoblastoma	Associate	10366578, 10631148, 10792382, 11533045, 12016586, 12541220, 1350208, 1352883, 14726655, 15166261, 15632311, 16061792, 1648218, 17609271, 18073428, 18503160, 19183342, 19252413, 19390654, 19491728, 19640284, 19653712, 20041760, 20607706, 20648557, 20664703, 20851996, 21253829, 21387305, 21505449, 21548012, 21615945, 22027510, 22203219, 22205104, 22219649, 22278416, 22336108, 22355046, 22909775, 22916154, 23224327, 23233783, 23441118, 23498719, 23756868, 24282159, 24406863, 24509483, 24755883, 24761912, 24791139, 24814393, 25403557, 25424699, 2556261, 25602518, 2569269, 25928201, 25999316, 2601691, 26117602, 26288838, 26396485, 26530098, 26539030, 26753011, 26925970, 27096027, 27126562, 27155049, 27318443, 27582626, 2765366, 27661116, 27879208, 27983729, 28000698, 28106538, 28193182, 28210099, 28211617, 28575107, 28668075, 28713896, 28780672, 28861107, 2898730, 29016839, 29143233, 29261756, 2927388, 29379195, 29415984, 29568217, 29579639, 29662154, 2994066, 30030888, 30223826, 30584916, 30636860, 30777982, 30996590, 31207142, 31404748, 31568710, 31736278, 31768671, 31806026, 31832685, 31916728, 31973216, 32139107, 32222358, 32277725, 32556071, 32633890, 32799607, 33063942, 33225895, 33258708, 33456302, 33760207, 33827698, 33913866, 34003213, 34294096, 34336010, 34552068, 34639028, 34656762, 34799705, 3480530, 35014072, 35288594, 35325233, 35361938, 35382685, 35412907, 35626705, 35867756, 35960463, 36173648, 36175480, 36342106, 36528757, 36543599, 36735656, 37191489, 37239954, 37536559, 37548407, 37682130, 37708614, 37777551, 37932687, 38040321, 38222455, 38300595, 38335663, 38452707, 38454873, 39738380, 39778672, 7666401, 7926730, 8131841, 8178820, 8217609, 8343223, 8346255, 8651278, 8703379, 8755916, 9224612, 9311732, 9400934, 9420334
Retinoblastoma	Inhibit	11462030, 18782450, 21329664, 22232672, 22615382, 23826078, 24911651, 25252974, 26143641, 28575107, 29246572, 30312872, 30355646, 30996590, 32268247, 32390242, 33525094, 34315877, 34573300, 9192669, 9793651
Rhabdomyosarcoma	Associate	37593416
Rupture	Associate	36303246
Salivary Duct Calculi	Associate	14645349, 32929114
Sarcoma	Associate	15988141, 17094467, 29100075, 31568710, 36603130, 37536918, 7547254
Sarcoma	Inhibit	2217208
Sarcoma Ewing	Associate	11520274
Schizophrenia	Associate	15057823
Sebaceous Gland Neoplasms	Associate	34445161
Sezary Syndrome	Inhibit	16614728
Sezary Syndrome	Associate	26551667
Silver Russell Syndrome	Associate	25563730
Sinonasal undifferentiated carcinoma	Associate	36946265
Small Cell Lung Carcinoma	Associate	20615970, 2168563, 24978188, 25122428, 25758528, 25863124, 26008974, 26340530, 26647789, 26802149, 26960398, 27093186, 27105536, 27145273, 28228136, 28285684, 30773851, 31109352, 31199602, 31292388, 31781628, 31959344, 32600081, 33144445, 33880365, 34396834, 34645133, 35016432, 35596192, 35641209, 35792876, 35815661, 36044718, 36399634, 36528757, 36583000, 36705363, 36705391, 36717865, 36810856, 37390276, 38159439, 38237798, 39283755
Small Cell Lung Carcinoma	Inhibit	28106103, 8052667, 9192669
Smooth Muscle Tumor	Associate	19808856
Soft Tissue Injuries	Associate	38488807
Soft Tissue Neoplasms	Associate	2765366, 29976943
Somatoform Disorders	Associate	36342106
Squamous Cell Carcinoma of Head and Neck	Associate	10389982, 15083191, 16467168, 16623759, 20226061, 23778529, 24982332, 26265441, 28984303, 29443735, 30189895, 30949979, 33172332, 33767253, 33830464
Squamous Cell Carcinoma of Head and Neck	Inhibit	27507850
Squamous Intraepithelial Lesions	Associate	12657136
Squamous Intraepithelial Lesions	Inhibit	16740689
Status Asthmaticus	Associate	16510457
Stickler syndrome type 3	Associate	33063942
Stomach Diseases	Associate	25631875, 34585958
Stomach Neoplasms	Associate	15906946, 17131485, 26867682, 27629734, 29791595, 35969010, 37843333, 7947078
Sveinsson Chorioretinal Atrophy	Associate	32931935, 34493366
Teratoma	Associate	25522918
Teratozoospermia	Associate	25762640
Testicular Germ Cell Tumor	Inhibit	17167184
Tetrasomy	Associate	15138476
Thymic epithelial tumor	Associate	26537237, 36307042
Thymoma	Associate	37749819
Thymus Neoplasms	Associate	37749819
Thyroid cancer follicular	Associate	21983636
Thyroid cancer medullary	Associate	27610696
Thyroid Carcinoma Anaplastic	Associate	28489587
Thyroid Neoplasms	Associate	15136974, 29271997
Tonsillar Neoplasms	Associate	19305381
Trichodysplasia Xeroderma	Associate	25291363
Triple Negative Breast Neoplasms	Associate	19372580, 21593597, 24096545, 24265703, 25961742, 29915391, 30704524, 31836816, 32075943, 32242058, 32377705, 34396843, 34525987, 36203222
Trisomy 13 Syndrome	Associate	2201915
Urethral Neoplasms	Associate	20890425, 22685613, 30293995, 38219954, 8950161
Urinary Bladder Diseases	Inhibit	29763719
Urinary Bladder Neoplasms	Associate	10376969, 12865920, 12875971, 14728297, 15226775, 15790699, 16402033, 17311305, 17384651, 17702869, 18008359, 19846973, 23897969, 24459064, 27270441, 27699256, 27835695, 29524168, 30279572, 31233191, 33879103, 34953602, 36083778, 36528757, 36818471, 7710951, 7860618, 9436977
Uterine Cervical Dysplasia	Associate	11737469
Uterine Cervical Dysplasia	Inhibit	40362654
Uterine Cervical Neoplasms	Associate	10982822, 12657136, 15143339, 16004614, 1648218, 16740689, 17582001, 21835799, 2198278, 22692183, 23284001, 23874455, 30575267, 36807750, 36894874, 37699974, 9215125
Uterine Cervical Neoplasms	Inhibit	39481992, 40362654
Uterine Cervicitis	Associate	26032781
Uterine Diseases	Associate	34162378
Vascular Diseases	Associate	18981572
Viremia	Associate	22701041
Virus Diseases	Inhibit	12657136
Vulvar Diseases	Associate	11737469
Vulvar Neoplasms	Associate	11737469
Waldenstrom Macroglobulinemia	Associate	40349989
Weight Gain	Associate	23315497
Weight Loss	Associate	23315497
Wilms Tumor	Associate	22219649, 26925970