Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5925
Gene name	RB transcriptional corepressor 1
Gene symbol	RB1
Synonyms (NCBI Gene)	OSRCPPP1R130RBp105-Rbp110-RB1pRbpp110
Chromosome	13
Chromosome location	13q14.2
Summary	The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophospho

162

Show/Hide all (162)

SNP ID	Visualize variation	Clinical significance	Consequence
rs3092895	A>G,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant, missense variant
rs121913295	G>T	Likely-pathogenic	Missense variant, coding sequence variant
rs121913296	G>T	Likely-pathogenic, pathogenic	Stop gained, coding sequence variant
rs121913297	G>A,T	Uncertain-significance, likely-pathogenic, pathogenic	Stop gained, missense variant, coding sequence variant
rs121913298	T>A	Likely-pathogenic	Stop gained, coding sequence variant
rs121913305	C>T	Pathogenic	Stop gained, coding sequence variant
rs137853292	C>T	Pathogenic	Missense variant, coding sequence variant
rs137853293	C>T	Pathogenic	Stop gained, coding sequence variant
rs137853294	C>T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs137853295	G>T	Pathogenic	Stop gained, coding sequence variant
rs137853296	T>C	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs137853297	T>A	Pathogenic	Stop gained, coding sequence variant
rs142509759	C>A,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant, synonymous variant
rs143685082	A>G	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Intron variant
rs145310579	T>C	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant
rs373601944	G>A,T	Not-provided, conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs376886420	A>C,G	Likely-benign, uncertain-significance, likely-pathogenic	Intron variant
rs398123333	GAATGAGTATGAA>CAC	Pathogenic	Coding sequence variant, frameshift variant
rs483352689	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs483352690	G>A,C	Conflicting-interpretations-of-pathogenicity, pathogenic	Coding sequence variant, missense variant
rs587776779	G>-	Pathogenic	Splice donor variant, coding sequence variant
rs587776780	T>C	Pathogenic	Splice donor variant
rs587776781	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs587776784	AATCTGCTTG>-	Pathogenic	Frameshift variant, coding sequence variant
rs587776785	TTTATAAAA>-	Pathogenic	Inframe indel, stop gained, coding sequence variant
rs587776786	G>A	Pathogenic	Splice acceptor variant
rs587776787	G>A,T	Pathogenic	Synonymous variant, missense variant, coding sequence variant
rs587776789	G>A,T	Pathogenic	Splice donor variant
rs587776791	A>G	Pathogenic	Intron variant
rs587778824	->TA	Pathogenic	Genic upstream transcript variant, stop gained, coding sequence variant
rs587778825	GT>-	Pathogenic	Frameshift variant, coding sequence variant
rs587778826	G>A,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs587778827	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs587778833	C>T	Pathogenic	Stop gained, coding sequence variant
rs587778835	C>T	Pathogenic	Missense variant, coding sequence variant
rs587778836	->TGAT	Pathogenic	Frameshift variant, coding sequence variant
rs587778837	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs587778838	G>A	Pathogenic	Splice acceptor variant
rs587778839	T>C	Pathogenic	Splice donor variant
rs587778840	A>-	Pathogenic	Genic upstream transcript variant, frameshift variant, coding sequence variant
rs587778841	TGCT>-	Pathogenic	Frameshift variant, coding sequence variant
rs587778842	C>T	Pathogenic	Stop gained, coding sequence variant
rs587778849	A>T	Pathogenic	Stop gained, coding sequence variant
rs587778850	G>A,T	Pathogenic	Splice donor variant
rs587778851	->C	Pathogenic	Frameshift variant, coding sequence variant
rs587778854	->T	Pathogenic	Frameshift variant, coding sequence variant
rs587778858	G>T	Pathogenic	Stop gained, coding sequence variant
rs587778859	G>A	Pathogenic	Missense variant, coding sequence variant
rs587778860	G>A,C	Likely-pathogenic, pathogenic	Splice acceptor variant
rs587778861	T>A,C	Pathogenic	Synonymous variant, stop gained, coding sequence variant
rs587778862	AG>-	Pathogenic	Genic upstream transcript variant, frameshift variant, coding sequence variant
rs587778864	C>T	Pathogenic	Stop gained, coding sequence variant
rs587778865	T>A	Pathogenic	Stop gained, coding sequence variant
rs587778866	A>G	Pathogenic	Missense variant, coding sequence variant
rs587778867	A>T	Pathogenic	Splice acceptor variant
rs587778868	G>T	Pathogenic	Stop gained, coding sequence variant
rs587778870	C>G,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs587778871	G>A,C	Likely-pathogenic, pathogenic	Intron variant
rs587781257	T>-	Pathogenic	Frameshift variant, coding sequence variant
rs748094394	G>A,C	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant
rs750136284	T>A,C	Likely-pathogenic, likely-benign	Synonymous variant, stop gained, coding sequence variant
rs764754259	G>A,C	Pathogenic	Splice donor variant
rs768305224	C>A,T	Pathogenic	Stop gained, coding sequence variant, missense variant
rs774744607	T>A,C,G	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs794727199	G>A	Pathogenic	Splice acceptor variant
rs794727372	C>A,T	Pathogenic, likely-benign	Coding sequence variant, synonymous variant, stop gained
rs794727481	G>A	Pathogenic	Coding sequence variant, stop gained
rs878853949	C>T	Pathogenic	Coding sequence variant, stop gained
rs886042249	G>A	Pathogenic, uncertain-significance	Intron variant
rs886042357	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs886042935	C>T	Pathogenic	Coding sequence variant, stop gained
rs886043313	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1060503067	G>T	Pathogenic	Coding sequence variant, stop gained
rs1060503075	CCTC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1060503088	T>G	Pathogenic	Intron variant
rs1064795296	T>-	Pathogenic	Splice donor variant
rs1064795438	AGATG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1131690842	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690843	G>A,C	Likely-pathogenic	Coding sequence variant, missense variant
rs1131690844	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690847	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690849	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690857	A>G	Pathogenic	Coding sequence variant, missense variant
rs1131690858	GAGT>-	Pathogenic	Intron variant, splice donor variant
rs1131690862	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1131690863	C>T	Pathogenic	Coding sequence variant, stop gained
rs1131690864	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1131690865	C>T	Pathogenic	Coding sequence variant, stop gained
rs1131690866	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690867	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690868	TATATTTC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690871	C>-	Pathogenic	Coding sequence variant, stop gained
rs1131690874	G>T	Pathogenic	Coding sequence variant, stop gained
rs1131690878	G>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690880	G>T	Pathogenic	Splice donor variant
rs1131690881	G>A,T	Pathogenic, likely-pathogenic	Intron variant
rs1131690882	G>A,C	Pathogenic, likely-pathogenic	Splice donor variant
rs1131690885	TCTG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690887	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690890	TA>ATC	Pathogenic	Coding sequence variant, frameshift variant
rs1131690891	G>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1131690893	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690894	AATA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690895	->T	Likely-pathogenic	Splice donor variant
rs1131690896	GGCAT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690899	T>G	Pathogenic	Splice donor variant
rs1131690902	G>A	Pathogenic	Splice donor variant
rs1131690903	G>T	Pathogenic	Coding sequence variant, stop gained
rs1131690904	G>T	Pathogenic	Coding sequence variant, stop gained
rs1131690905	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690906	C>A,T	Uncertain-significance, pathogenic	Coding sequence variant, missense variant, stop gained
rs1131690907	G>A	Pathogenic	Genic upstream transcript variant, splice donor variant
rs1131690908	C>A,G	Pathogenic	Coding sequence variant, stop gained
rs1131690912	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131690915	C>T	Pathogenic	Coding sequence variant, stop gained
rs1555282775	A>T	Pathogenic	Stop gained, coding sequence variant
rs1555282811	A>T	Pathogenic	Intron variant
rs1555283482	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1555283670	->ATTAG	Pathogenic	Stop gained, coding sequence variant, inframe indel
rs1555284956	G>A,C	Pathogenic	Synonymous variant, coding sequence variant, missense variant
rs1555294600	->AA	Pathogenic	Coding sequence variant, frameshift variant
rs1555294626	AAGG>TTT	Pathogenic	Coding sequence variant, frameshift variant
rs1555294634	AGGTGTGTG>-	Pathogenic	Coding sequence variant, splice donor variant, intron variant
rs1555294636	T>C	Likely-pathogenic	Splice donor variant
rs1555295354	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1566186087	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1566186125	TA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1566186836	G>A	Pathogenic	Splice acceptor variant
rs1566186840	A>T	Pathogenic	Stop gained, coding sequence variant
rs1566186889	->TGAT	Pathogenic	Stop gained, coding sequence variant
rs1566187856	G>A	Likely-pathogenic	Splice donor variant
rs1566192530	AACAG>-	Pathogenic	Coding sequence variant, frameshift variant
rs1566192557	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs1566233014	->G	Pathogenic	Coding sequence variant, frameshift variant
rs1566233076	C>T	Pathogenic	Stop gained, coding sequence variant
rs1566234123	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1566235470	C>T	Pathogenic	Stop gained, coding sequence variant
rs1566235515	T>A,C	Likely-pathogenic, pathogenic	Splice donor variant
rs1566237098	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1566240909	CT>-	Pathogenic	Stop gained, coding sequence variant
rs1593414337	G>A	Likely-pathogenic	Genic upstream transcript variant, splice acceptor variant
rs1593434175	ATATT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1593438023	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1593443514	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs1593445096	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1593445220	TAATATAG>-	Pathogenic	Stop gained, coding sequence variant, inframe indel
rs1593445246	G>T	Pathogenic	Stop gained, coding sequence variant
rs1593529868	A>G	Likely-pathogenic	Splice acceptor variant
rs1593532084	TTAT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1593532101	->C	Pathogenic	Splice donor variant
rs1593534586	CTCCGGCTAAATACACTTT>-	Pathogenic	Coding sequence variant, frameshift variant
rs1593538130	A>G	Pathogenic	Splice acceptor variant
rs1593538155	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1593538175	ATTCAAAA>C	Pathogenic	Coding sequence variant, frameshift variant
rs1593538220	C>T	Pathogenic	Stop gained, coding sequence variant
rs1593539225	C>A,T	Pathogenic, uncertain-significance	Stop gained, coding sequence variant, missense variant
rs1593539366	C>G	Pathogenic	Stop gained, coding sequence variant
rs1593539386	->GCCCTTACAAGTTTCCTAGTTC	Pathogenic	Stop gained, inframe insertion, coding sequence variant
rs1593539435	GGAACATCTA>-	Pathogenic	Coding sequence variant, frameshift variant
rs1593539493	C>A	Pathogenic	Stop gained, coding sequence variant
rs1593539538	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1593544647	GA>-	Pathogenic	Coding sequence variant, splice acceptor variant

401

Show/Hide all (401)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001840	hsa-miR-106a-5p	Microarray	19175831
MIRT003587	hsa-miR-335-5p	Luciferase reporter assayWestern blot	20713524
MIRT003587	hsa-miR-335-5p	Luciferase reporter assayWestern blot	20713524
MIRT003425	hsa-miR-23b-3p	flowMicroarray	20133741
MIRT003213	hsa-miR-26a-5p	GFP reporter assayLuciferase reporter assayWestern blot	20080666
MIRT001840	hsa-miR-106a-5p	immunohistochemistryMicroarray	19175831
MIRT004664	hsa-miR-106b-5p	immunohistochemistryMicroarray	19175831
MIRT004749	hsa-miR-675-5p	Luciferase reporter assayqRT-PCR	19926638
MIRT001840	hsa-miR-106a-5p	ImmunohistochemistryMicroarrayWestern blot	20643754
MIRT001840	hsa-miR-106a-5p	and lung tumor samples"	16461460
MIRT005850	hsa-miR-17-5p	Luciferase reporter assay	21283765
MIRT005857	hsa-miR-20a-5p	Luciferase reporter assay	21283765
MIRT004664	hsa-miR-106b-5p	Luciferase reporter assay	21283765
MIRT001840	hsa-miR-106a-5p	Luciferase reporter assayqRT-PCRWestern blot	20889678
MIRT006435	hsa-miR-192-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	21511813
MIRT006435	hsa-miR-192-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	21511813
MIRT006503	hsa-miR-132-3p	Luciferase reporter assayWestern blot	21329664
MIRT006503	hsa-miR-132-3p	Luciferase reporter assayWestern blot	21329664
MIRT006504	hsa-miR-212-3p	Luciferase reporter assayWestern blot	21329664
MIRT006504	hsa-miR-212-3p	Luciferase reporter assayWestern blot	21329664
MIRT006435	hsa-miR-192-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	21511813
MIRT006503	hsa-miR-132-3p	Luciferase reporter assayWestern blot	21329664
MIRT006503	hsa-miR-132-3p	Luciferase reporter assayWestern blot	21329664
MIRT006504	hsa-miR-212-3p	Luciferase reporter assayWestern blot	21329664
MIRT006504	hsa-miR-212-3p	Luciferase reporter assayWestern blot	21329664
MIRT003587	hsa-miR-335-5p	qRT-PCRWestern blot	22886530
MIRT004664	hsa-miR-106b-5p	Luciferase reporter assayqRT-PCRWestern blot	21819631
MIRT003213	hsa-miR-26a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23108995
MIRT003213	hsa-miR-26a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23108995
MIRT020177	hsa-miR-130b-3p	Sequencing	20371350
MIRT004664	hsa-miR-106b-5p	Microarray	17242205
MIRT006503	hsa-miR-132-3p	Reporter assay;Western blot;qRT-PCR	21329664
MIRT024341	hsa-miR-215-5p	Microarray	19074876
MIRT006504	hsa-miR-212-3p	Reporter assay;Western blot;qRT-PCR	21329664
MIRT006435	hsa-miR-192-5p	Microarray	19074876
MIRT001840	hsa-miR-106a-5p	Reporter assay	16461460
MIRT028033	hsa-miR-93-5p	Sequencing	20371350
MIRT030738	hsa-miR-21-5p	Microarray	18591254
MIRT048653	hsa-miR-99a-5p	CLASH	23622248
MIRT048586	hsa-miR-100-5p	CLASH	23622248
MIRT045442	hsa-miR-149-5p	CLASH	23622248
MIRT001840	hsa-miR-106a-5p	Microarray	23807165
MIRT001840	hsa-miR-106a-5p	ImmunohistochemistryqRT-PCR	18996365
MIRT024341	hsa-miR-215-5p	ImmunofluorescenceLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23981575
MIRT024341	hsa-miR-215-5p	ImmunofluorescenceLuciferase reporter assayMicroarrayqRT-PCRWestern blot	23981575
MIRT054352	hsa-miR-221-3p	Luciferase reporter assayQRTPCRWestern blot	23630541
MIRT437472	hsa-miR-26b-5p	Luciferase reporter assayqRT-PCRWestern blot	24027266
MIRT437472	hsa-miR-26b-5p	Luciferase reporter assayqRT-PCRWestern blot	24027266
MIRT006435	hsa-miR-192-5p	Luciferase reporter assayqRT-PCRWestern blot	24012720
MIRT068755	hsa-miR-519a-3p	qRT-PCRLuciferase reporter assayWestern blot	24752803
MIRT068755	hsa-miR-519a-3p	qRT-PCRLuciferase reporter assayWestern blot	24752803
MIRT068754	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT005850	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT004664	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT068752	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028033	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT001840	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT005857	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT068749	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT068755	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT068753	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT068751	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT068761	hsa-miR-4318	PAR-CLIP	21572407
MIRT068756	hsa-miR-892a	PAR-CLIP	21572407
MIRT554909	hsa-miR-1178-5p	PAR-CLIP	21572407
MIRT554908	hsa-miR-1182	PAR-CLIP	21572407
MIRT068763	hsa-miR-3614-5p	PAR-CLIP	21572407
MIRT554907	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT554906	hsa-miR-3909	PAR-CLIP	21572407
MIRT554905	hsa-miR-6852-3p	PAR-CLIP	21572407
MIRT068760	hsa-miR-3152-3p	PAR-CLIP	21572407
MIRT554904	hsa-miR-1258	PAR-CLIP	21572407
MIRT068765	hsa-miR-4693-5p	PAR-CLIP	21572407
MIRT068762	hsa-miR-4325	PAR-CLIP	21572407
MIRT554903	hsa-miR-450b-3p	PAR-CLIP	21572407
MIRT554902	hsa-miR-769-3p	PAR-CLIP	21572407
MIRT554901	hsa-miR-6728-5p	PAR-CLIP	21572407
MIRT554900	hsa-miR-5089-5p	PAR-CLIP	21572407
MIRT068766	hsa-miR-6513-5p	PAR-CLIP	21572407
MIRT731073	hsa-miR-141-3p	5.0	25241899
MIRT731073	hsa-miR-141-3p	5.0	25241899
MIRT731073	hsa-miR-141-3p	5.0	25241899
MIRT731073	hsa-miR-141-3p	5.0	25241899
MIRT731073	hsa-miR-141-3p	5.0	25241899
MIRT731073	hsa-miR-141-3p	5.0	25241899
MIRT004664	hsa-miR-106b-5p	Luciferase reporter assayMicroarrayWestern blot	24292682
MIRT004664	hsa-miR-106b-5p	Luciferase reporter assayMicroarrayWestern blot	24292682
MIRT006503	hsa-miR-132-3p	MicroarrayRNA-seq	31426562
MIRT735221	hsa-miR-181a-3p	Luciferase reporter assayWestern blottingMicroarrayImmunohistochemistry (IHC)qRT-PCRImmunocytochemistry (ICC)ELISA	32591511
MIRT068749	hsa-miR-20b-5p	Luciferase reporter assayWestern blottingqRT-PCRIn situ hybridization	32622332
MIRT068754	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT005850	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT004664	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT068752	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028033	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT001840	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT005857	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT068749	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT068755	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT068753	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT068751	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT068761	hsa-miR-4318	PAR-CLIP	21572407
MIRT068756	hsa-miR-892a	PAR-CLIP	21572407
MIRT554909	hsa-miR-1178-5p	PAR-CLIP	21572407
MIRT554908	hsa-miR-1182	PAR-CLIP	21572407
MIRT068763	hsa-miR-3614-5p	PAR-CLIP	21572407
MIRT554907	hsa-miR-494-3p	PAR-CLIP	21572407
MIRT554906	hsa-miR-3909	PAR-CLIP	21572407
MIRT554905	hsa-miR-6852-3p	PAR-CLIP	21572407
MIRT068760	hsa-miR-3152-3p	PAR-CLIP	21572407
MIRT554904	hsa-miR-1258	PAR-CLIP	21572407
MIRT068765	hsa-miR-4693-5p	PAR-CLIP	21572407
MIRT068762	hsa-miR-4325	PAR-CLIP	21572407
MIRT554903	hsa-miR-450b-3p	PAR-CLIP	21572407
MIRT554902	hsa-miR-769-3p	PAR-CLIP	21572407
MIRT554901	hsa-miR-6728-5p	PAR-CLIP	21572407
MIRT554900	hsa-miR-5089-5p	PAR-CLIP	21572407
MIRT068766	hsa-miR-6513-5p	PAR-CLIP	21572407
MIRT006435	hsa-miR-192-5p	Luciferase reporter assayImmunoprecipitaion (IP)CLIP-seqFlow cytometry	35969010
MIRT1293359	hsa-miR-1245	CLIP-seq
MIRT1293360	hsa-miR-1257	CLIP-seq
MIRT1293361	hsa-miR-1273d	CLIP-seq
MIRT1293362	hsa-miR-128	CLIP-seq
MIRT1293363	hsa-miR-1283	CLIP-seq
MIRT1293364	hsa-miR-129-5p	CLIP-seq
MIRT1293365	hsa-miR-155	CLIP-seq
MIRT1293366	hsa-miR-221	CLIP-seq
MIRT1293367	hsa-miR-222	CLIP-seq
MIRT1293368	hsa-miR-298	CLIP-seq
MIRT1293369	hsa-miR-3119	CLIP-seq
MIRT1293370	hsa-miR-3128	CLIP-seq
MIRT1293371	hsa-miR-3146	CLIP-seq
MIRT1293372	hsa-miR-3177-5p	CLIP-seq
MIRT1293373	hsa-miR-3187-3p	CLIP-seq
MIRT1293374	hsa-miR-340	CLIP-seq
MIRT1293375	hsa-miR-365	CLIP-seq
MIRT1293376	hsa-miR-3678-3p	CLIP-seq
MIRT1293377	hsa-miR-3921	CLIP-seq
MIRT1293378	hsa-miR-3973	CLIP-seq
MIRT1293379	hsa-miR-4257	CLIP-seq
MIRT1293380	hsa-miR-4263	CLIP-seq
MIRT1293381	hsa-miR-4276	CLIP-seq
MIRT1293382	hsa-miR-4282	CLIP-seq
MIRT1293383	hsa-miR-4427	CLIP-seq
MIRT1293384	hsa-miR-4474-3p	CLIP-seq
MIRT1293385	hsa-miR-450b-5p	CLIP-seq
MIRT1293386	hsa-miR-4529-5p	CLIP-seq
MIRT1293387	hsa-miR-4653-5p	CLIP-seq
MIRT1293388	hsa-miR-4670-3p	CLIP-seq
MIRT1293389	hsa-miR-4672	CLIP-seq
MIRT1293390	hsa-miR-4677-3p	CLIP-seq
MIRT1293391	hsa-miR-4679	CLIP-seq
MIRT1293392	hsa-miR-4680-3p	CLIP-seq
MIRT1293393	hsa-miR-4699-5p	CLIP-seq
MIRT1293394	hsa-miR-4704-3p	CLIP-seq
MIRT1293395	hsa-miR-4720-5p	CLIP-seq
MIRT1293396	hsa-miR-4725-5p	CLIP-seq
MIRT1293397	hsa-miR-4735-5p	CLIP-seq
MIRT1293398	hsa-miR-4775	CLIP-seq
MIRT1293399	hsa-miR-4780	CLIP-seq
MIRT1293400	hsa-miR-4789-5p	CLIP-seq
MIRT1293401	hsa-miR-4790-3p	CLIP-seq
MIRT1293402	hsa-miR-4799-3p	CLIP-seq
MIRT1293403	hsa-miR-494	CLIP-seq
MIRT1293404	hsa-miR-499-3p	CLIP-seq
MIRT1293405	hsa-miR-499a-3p	CLIP-seq
MIRT1293406	hsa-miR-504	CLIP-seq
MIRT1293407	hsa-miR-507	CLIP-seq
MIRT1293408	hsa-miR-520a-5p	CLIP-seq
MIRT1293409	hsa-miR-525-5p	CLIP-seq
MIRT1293410	hsa-miR-548v	CLIP-seq
MIRT1293411	hsa-miR-557	CLIP-seq
MIRT1293412	hsa-miR-576-5p	CLIP-seq
MIRT1293413	hsa-miR-590-3p	CLIP-seq
MIRT1293414	hsa-miR-663b	CLIP-seq
MIRT1293415	hsa-miR-889	CLIP-seq
MIRT1552966	hsa-miR-3942-5p	CLIP-seq
MIRT1552967	hsa-miR-4422	CLIP-seq
MIRT1552968	hsa-miR-4703-5p	CLIP-seq
MIRT2087155	hsa-miR-1296	CLIP-seq
MIRT2087156	hsa-miR-1912	CLIP-seq
MIRT2087157	hsa-miR-323b-3p	CLIP-seq
MIRT2087158	hsa-miR-3908	CLIP-seq
MIRT1552966	hsa-miR-3942-5p	CLIP-seq
MIRT1293382	hsa-miR-4282	CLIP-seq
MIRT2087159	hsa-miR-4328	CLIP-seq
MIRT1552967	hsa-miR-4422	CLIP-seq
MIRT2087160	hsa-miR-4436a	CLIP-seq
MIRT2087161	hsa-miR-4512	CLIP-seq
MIRT1293390	hsa-miR-4677-3p	CLIP-seq
MIRT1293391	hsa-miR-4679	CLIP-seq
MIRT1552968	hsa-miR-4703-5p	CLIP-seq
MIRT2087162	hsa-miR-4766-3p	CLIP-seq
MIRT1293398	hsa-miR-4775	CLIP-seq
MIRT2087163	hsa-miR-4803	CLIP-seq
MIRT1293403	hsa-miR-494	CLIP-seq
MIRT1293408	hsa-miR-520a-5p	CLIP-seq
MIRT1293409	hsa-miR-525-5p	CLIP-seq
MIRT2087164	hsa-miR-550b	CLIP-seq
MIRT1293412	hsa-miR-576-5p	CLIP-seq
MIRT2087165	hsa-miR-582-5p	CLIP-seq
MIRT1293413	hsa-miR-590-3p	CLIP-seq
MIRT2087166	hsa-miR-711	CLIP-seq
MIRT2087167	hsa-miR-802	CLIP-seq
MIRT2311988	hsa-miR-1197	CLIP-seq
MIRT1293362	hsa-miR-128	CLIP-seq
MIRT2087155	hsa-miR-1296	CLIP-seq
MIRT2311989	hsa-miR-1297	CLIP-seq
MIRT2087156	hsa-miR-1912	CLIP-seq
MIRT2311990	hsa-miR-26a	CLIP-seq
MIRT2311991	hsa-miR-26b	CLIP-seq
MIRT2311992	hsa-miR-3120-3p	CLIP-seq
MIRT2311993	hsa-miR-3153	CLIP-seq
MIRT2311994	hsa-miR-3156-3p	CLIP-seq
MIRT1293372	hsa-miR-3177-5p	CLIP-seq
MIRT2311995	hsa-miR-3180-5p	CLIP-seq
MIRT2311996	hsa-miR-33a	CLIP-seq
MIRT2311997	hsa-miR-33b	CLIP-seq
MIRT2311998	hsa-miR-361-5p	CLIP-seq
MIRT2311999	hsa-miR-3919	CLIP-seq
MIRT1293377	hsa-miR-3921	CLIP-seq
MIRT1293379	hsa-miR-4257	CLIP-seq
MIRT1293382	hsa-miR-4282	CLIP-seq
MIRT2312000	hsa-miR-4301	CLIP-seq
MIRT1552967	hsa-miR-4422	CLIP-seq
MIRT2087160	hsa-miR-4436a	CLIP-seq
MIRT2312001	hsa-miR-4465	CLIP-seq
MIRT2087161	hsa-miR-4512	CLIP-seq
MIRT1293387	hsa-miR-4653-5p	CLIP-seq
MIRT2312002	hsa-miR-4662a-3p	CLIP-seq
MIRT1293388	hsa-miR-4670-3p	CLIP-seq
MIRT1293389	hsa-miR-4672	CLIP-seq
MIRT1293390	hsa-miR-4677-3p	CLIP-seq
MIRT1293391	hsa-miR-4679	CLIP-seq
MIRT1293394	hsa-miR-4704-3p	CLIP-seq
MIRT1293398	hsa-miR-4775	CLIP-seq
MIRT1293400	hsa-miR-4789-5p	CLIP-seq
MIRT1293403	hsa-miR-494	CLIP-seq
MIRT2312003	hsa-miR-498	CLIP-seq
MIRT1293408	hsa-miR-520a-5p	CLIP-seq
MIRT1293409	hsa-miR-525-5p	CLIP-seq
MIRT2312004	hsa-miR-532-3p	CLIP-seq
MIRT2087164	hsa-miR-550b	CLIP-seq
MIRT2312005	hsa-miR-570	CLIP-seq
MIRT1293413	hsa-miR-590-3p	CLIP-seq
MIRT2312006	hsa-miR-7	CLIP-seq
MIRT2087166	hsa-miR-711	CLIP-seq
MIRT1293399	hsa-miR-4780	CLIP-seq
MIRT2432464	hsa-miR-216a	CLIP-seq
MIRT2432465	hsa-miR-3200-5p	CLIP-seq
MIRT2432466	hsa-miR-3653	CLIP-seq
MIRT2432467	hsa-miR-3658	CLIP-seq
MIRT1293377	hsa-miR-3921	CLIP-seq
MIRT1293387	hsa-miR-4653-5p	CLIP-seq
MIRT1293388	hsa-miR-4670-3p	CLIP-seq
MIRT1293415	hsa-miR-889	CLIP-seq
MIRT2087155	hsa-miR-1296	CLIP-seq
MIRT2311994	hsa-miR-3156-3p	CLIP-seq
MIRT2312000	hsa-miR-4301	CLIP-seq
MIRT2087161	hsa-miR-4512	CLIP-seq
MIRT2087164	hsa-miR-550b	CLIP-seq
MIRT2087155	hsa-miR-1296	CLIP-seq
MIRT2311994	hsa-miR-3156-3p	CLIP-seq
MIRT2312000	hsa-miR-4301	CLIP-seq
MIRT2087161	hsa-miR-4512	CLIP-seq
MIRT2087164	hsa-miR-550b	CLIP-seq
MIRT2608358	hsa-miR-1269	CLIP-seq
MIRT2608359	hsa-miR-1269b	CLIP-seq
MIRT2608360	hsa-miR-127-5p	CLIP-seq
MIRT2608361	hsa-miR-1276	CLIP-seq
MIRT2608362	hsa-miR-129-3p	CLIP-seq
MIRT2087155	hsa-miR-1296	CLIP-seq
MIRT2311989	hsa-miR-1297	CLIP-seq
MIRT2608363	hsa-miR-1301	CLIP-seq
MIRT2087156	hsa-miR-1912	CLIP-seq
MIRT2608364	hsa-miR-192	CLIP-seq
MIRT2608365	hsa-miR-2054	CLIP-seq
MIRT2608366	hsa-miR-215	CLIP-seq
MIRT2311990	hsa-miR-26a	CLIP-seq
MIRT2311991	hsa-miR-26b	CLIP-seq
MIRT2608367	hsa-miR-297	CLIP-seq
MIRT1293368	hsa-miR-298	CLIP-seq
MIRT2311992	hsa-miR-3120-3p	CLIP-seq
MIRT2608368	hsa-miR-3125	CLIP-seq
MIRT2608369	hsa-miR-3130-3p	CLIP-seq
MIRT2608370	hsa-miR-3140-3p	CLIP-seq
MIRT2608371	hsa-miR-3143	CLIP-seq
MIRT2608372	hsa-miR-3145-3p	CLIP-seq
MIRT2608373	hsa-miR-3149	CLIP-seq
MIRT2311994	hsa-miR-3156-3p	CLIP-seq
MIRT2608374	hsa-miR-3160-3p	CLIP-seq
MIRT2608375	hsa-miR-3175	CLIP-seq
MIRT2608376	hsa-miR-3667-5p	CLIP-seq
MIRT2608377	hsa-miR-377	CLIP-seq
MIRT2608378	hsa-miR-3916	CLIP-seq
MIRT2608379	hsa-miR-4261	CLIP-seq
MIRT1293380	hsa-miR-4263	CLIP-seq
MIRT2312000	hsa-miR-4301	CLIP-seq
MIRT1552967	hsa-miR-4422	CLIP-seq
MIRT2608380	hsa-miR-4434	CLIP-seq
MIRT2312001	hsa-miR-4465	CLIP-seq
MIRT2608381	hsa-miR-4496	CLIP-seq
MIRT1293385	hsa-miR-450b-5p	CLIP-seq
MIRT2087161	hsa-miR-4512	CLIP-seq
MIRT2608382	hsa-miR-4516	CLIP-seq
MIRT2608383	hsa-miR-4520b-3p	CLIP-seq
MIRT2608384	hsa-miR-4529-3p	CLIP-seq
MIRT2608385	hsa-miR-4637	CLIP-seq
MIRT2608386	hsa-miR-4660	CLIP-seq
MIRT2312002	hsa-miR-4662a-3p	CLIP-seq
MIRT1293393	hsa-miR-4699-5p	CLIP-seq
MIRT1293396	hsa-miR-4725-5p	CLIP-seq
MIRT2608387	hsa-miR-4728-5p	CLIP-seq
MIRT2608388	hsa-miR-4731-3p	CLIP-seq
MIRT1293398	hsa-miR-4775	CLIP-seq
MIRT1293399	hsa-miR-4780	CLIP-seq
MIRT2608389	hsa-miR-4793-3p	CLIP-seq
MIRT2608390	hsa-miR-4801	CLIP-seq
MIRT2312003	hsa-miR-498	CLIP-seq
MIRT1293406	hsa-miR-504	CLIP-seq
MIRT2608391	hsa-miR-5047	CLIP-seq
MIRT1293407	hsa-miR-507	CLIP-seq
MIRT2608392	hsa-miR-543	CLIP-seq
MIRT2608393	hsa-miR-548ac	CLIP-seq
MIRT2608394	hsa-miR-548ae	CLIP-seq
MIRT2608395	hsa-miR-548aj	CLIP-seq
MIRT2608396	hsa-miR-548am	CLIP-seq
MIRT2608397	hsa-miR-548d-3p	CLIP-seq
MIRT2608398	hsa-miR-548p	CLIP-seq
MIRT2608399	hsa-miR-548x	CLIP-seq
MIRT2608400	hsa-miR-548z	CLIP-seq
MIRT2087164	hsa-miR-550b	CLIP-seq
MIRT1293411	hsa-miR-557	CLIP-seq
MIRT1293412	hsa-miR-576-5p	CLIP-seq
MIRT1293413	hsa-miR-590-3p	CLIP-seq
MIRT2608401	hsa-miR-664	CLIP-seq
MIRT2312006	hsa-miR-7	CLIP-seq
MIRT2608358	hsa-miR-1269	CLIP-seq
MIRT2608359	hsa-miR-1269b	CLIP-seq
MIRT2689374	hsa-miR-1272	CLIP-seq
MIRT2608360	hsa-miR-127-5p	CLIP-seq
MIRT2689375	hsa-miR-1289	CLIP-seq
MIRT2608362	hsa-miR-129-3p	CLIP-seq
MIRT2087155	hsa-miR-1296	CLIP-seq
MIRT2311989	hsa-miR-1297	CLIP-seq
MIRT2608363	hsa-miR-1301	CLIP-seq
MIRT2087156	hsa-miR-1912	CLIP-seq
MIRT2608364	hsa-miR-192	CLIP-seq
MIRT2689376	hsa-miR-203	CLIP-seq
MIRT2608365	hsa-miR-2054	CLIP-seq
MIRT2608366	hsa-miR-215	CLIP-seq
MIRT2311990	hsa-miR-26a	CLIP-seq
MIRT2311991	hsa-miR-26b	CLIP-seq
MIRT2608367	hsa-miR-297	CLIP-seq
MIRT1293368	hsa-miR-298	CLIP-seq
MIRT2608369	hsa-miR-3130-3p	CLIP-seq
MIRT2608371	hsa-miR-3143	CLIP-seq
MIRT2608372	hsa-miR-3145-3p	CLIP-seq
MIRT2608373	hsa-miR-3149	CLIP-seq
MIRT2311994	hsa-miR-3156-3p	CLIP-seq
MIRT2608375	hsa-miR-3175	CLIP-seq
MIRT2689377	hsa-miR-3198	CLIP-seq
MIRT2608376	hsa-miR-3667-5p	CLIP-seq
MIRT2608377	hsa-miR-377	CLIP-seq
MIRT1293380	hsa-miR-4263	CLIP-seq
MIRT2689378	hsa-miR-4294	CLIP-seq
MIRT2312000	hsa-miR-4301	CLIP-seq
MIRT2689379	hsa-miR-4309	CLIP-seq
MIRT2608380	hsa-miR-4434	CLIP-seq
MIRT2312001	hsa-miR-4465	CLIP-seq
MIRT2087161	hsa-miR-4512	CLIP-seq
MIRT2608382	hsa-miR-4516	CLIP-seq
MIRT2608383	hsa-miR-4520b-3p	CLIP-seq
MIRT2608384	hsa-miR-4529-3p	CLIP-seq
MIRT2608385	hsa-miR-4637	CLIP-seq
MIRT2608386	hsa-miR-4660	CLIP-seq
MIRT2312002	hsa-miR-4662a-3p	CLIP-seq
MIRT2689380	hsa-miR-4694-3p	CLIP-seq
MIRT1293396	hsa-miR-4725-5p	CLIP-seq
MIRT2608387	hsa-miR-4728-5p	CLIP-seq
MIRT2608388	hsa-miR-4731-3p	CLIP-seq
MIRT1293398	hsa-miR-4775	CLIP-seq
MIRT1293399	hsa-miR-4780	CLIP-seq
MIRT2608389	hsa-miR-4793-3p	CLIP-seq
MIRT2608390	hsa-miR-4801	CLIP-seq
MIRT2312003	hsa-miR-498	CLIP-seq
MIRT1293406	hsa-miR-504	CLIP-seq
MIRT2608391	hsa-miR-5047	CLIP-seq
MIRT2608392	hsa-miR-543	CLIP-seq
MIRT2608393	hsa-miR-548ac	CLIP-seq
MIRT2608394	hsa-miR-548ae	CLIP-seq
MIRT2608395	hsa-miR-548aj	CLIP-seq
MIRT2608396	hsa-miR-548am	CLIP-seq
MIRT2608397	hsa-miR-548d-3p	CLIP-seq
MIRT2608398	hsa-miR-548p	CLIP-seq
MIRT2608399	hsa-miR-548x	CLIP-seq
MIRT2608400	hsa-miR-548z	CLIP-seq
MIRT2087164	hsa-miR-550b	CLIP-seq
MIRT1293412	hsa-miR-576-5p	CLIP-seq
MIRT1293413	hsa-miR-590-3p	CLIP-seq
MIRT2608401	hsa-miR-664	CLIP-seq

Show/Hide all (11)

Transcription factor	Regulation	Reference
BDP1	Unknown	12734418
CTNNB1	Repression	16628468
DNMT1	Repression	17934516
E2F1	Activation	8264596
KAT2B	Activation	19525977
PAX5	Unknown	10197586
RB1	Repression	8264596
RB1CC1	Activation	12095676
RB1CC1	Unknown	14533007;20614030
TP53	Unknown	8119988
UHRF1	Activation	16007129

128

Show/Hide all (128)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	19149898
GO:0000785	Component	Chromatin	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001894	Process	Tissue homeostasis	IEA
GO:0002062	Process	Chondrocyte differentiation	IEA
GO:0003180	Process	Aortic valve morphogenesis	IEA
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003714	Function	Transcription corepressor activity	TAS	19149898
GO:0005515	Function	Protein binding	IPI	1331501, 1870208, 2138977, 2153075, 2162480, 2189724, 7503932, 7592647, 7651420, 7664264, 7791904, 7890747, 7923370, 8756624, 9067421, 9395244, 9448006, 9468139, 9468140, 9608663, 9697699, 9858607, 9881977, 10613832, 10779361, 10783144, 10944455, 11073990, 11268000, 11571652, 12037672
GO:0005634	Component	Nucleus	IDA	1531329, 17540172
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	2730637
GO:0005634	Component	Nucleus	TAS	3657987
GO:0005654	Component	Nucleoplasm	IDA	8245034
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	TAS	19149898
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	1531329
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	2730637
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006469	Process	Negative regulation of protein kinase activity	IPI	9858607
GO:0006915	Process	Apoptotic process	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007265	Process	Ras protein signal transduction	IEP	9054499
GO:0007283	Process	Spermatogenesis	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IMP	20551165
GO:0008024	Component	Cyclin/CDK positive transcription elongation factor complex	IDA	12037672
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	25100735
GO:0014009	Process	Glial cell proliferation	IEA
GO:0016514	Component	SWI/SNF complex	TAS	19149898
GO:0016605	Component	PML body	IDA	9448006
GO:0019899	Function	Enzyme binding	IEA
GO:0019900	Function	Kinase binding	IDA	16286473
GO:0030154	Process	Cell differentiation	IBA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0030308	Process	Negative regulation of cell growth	ISS
GO:0031134	Process	Sister chromatid biorientation	IMP	20551165
GO:0031175	Process	Neuron projection development	IBA
GO:0031175	Process	Neuron projection development	IEA
GO:0031507	Process	Heterochromatin formation	IDA	17540172
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	10944455
GO:0032502	Process	Developmental process	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0034088	Process	Maintenance of mitotic sister chromatid cohesion	IMP	20551165
GO:0034349	Process	Glial cell apoptotic process	IEA
GO:0035189	Component	Rb-E2F complex	IBA
GO:0035189	Component	Rb-E2F complex	IDA	8245034
GO:0035189	Component	Rb-E2F complex	IEA
GO:0035189	Component	Rb-E2F complex	IPI	16360038
GO:0035189	Component	Rb-E2F complex	ISS
GO:0035189	Component	Rb-E2F complex	TAS	19149898
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0042551	Process	Neuron maturation	IEA
GO:0042802	Function	Identical protein binding	IPI	8288605, 16360038
GO:0043353	Process	Enucleate erythrocyte differentiation	IEA
GO:0043550	Process	Regulation of lipid kinase activity	IDA	16286473
GO:0045445	Process	Myoblast differentiation	IMP	15541338
GO:0045651	Process	Positive regulation of macrophage differentiation	IEA
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0045786	Process	Negative regulation of cell cycle	ISS	24027266
GO:0045842	Process	Positive regulation of mitotic metaphase/anaphase transition	IMP	20551165
GO:0045879	Process	Negative regulation of smoothened signaling pathway	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	10783144, 12065415, 19223331
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	17540172
GO:0045892	Process	Negative regulation of DNA-templated transcription	TAS	19149898
GO:0045930	Process	Negative regulation of mitotic cell cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048565	Process	Digestive tract development	IEA
GO:0048667	Process	Cell morphogenesis involved in neuron differentiation	IBA
GO:0048667	Process	Cell morphogenesis involved in neuron differentiation	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051219	Function	Phosphoprotein binding	IPI	16360038
GO:0051276	Process	Chromosome organization	IMP	20551165
GO:0051301	Process	Cell division	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	TAS	19149898
GO:0060090	Function	Molecular adaptor activity	EXP	16360038
GO:0060253	Process	Negative regulation of glial cell proliferation	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0061676	Function	Importin-alpha family protein binding	IPI	12695505
GO:0061793	Component	Chromatin lock complex	IPI	17540172
GO:0071459	Process	Protein localization to chromosome, centromeric region	IMP	20551165
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0090230	Process	Regulation of centromere complex assembly	TAS	20551165
GO:0097284	Process	Hepatocyte apoptotic process	IEA
GO:0097718	Function	Disordered domain specific binding	IPI	8245034
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	19417128
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	19223331
GO:1903055	Process	Positive regulation of extracellular matrix organization	IEA
GO:1903055	Process	Positive regulation of extracellular matrix organization	ISS
GO:1903944	Process	Negative regulation of hepatocyte apoptotic process	IEA
GO:1904028	Process	Positive regulation of collagen fibril organization	IEA
GO:1904028	Process	Positive regulation of collagen fibril organization	ISS
GO:1904761	Process	Negative regulation of myofibroblast differentiation	IEA
GO:1904761	Process	Negative regulation of myofibroblast differentiation	ISS
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IEA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IBA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IEA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	TAS	19149898
GO:2000679	Process	Positive regulation of transcription regulatory region DNA binding	IDA	25100735
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	ISS	24027266

MIM	HGNC	e!Ensembl
614041	9884	ENSG00000139687

P06400

Protein name

Retinoblastoma-associated protein (p105-Rb) (p110-RB1) (pRb) (Rb) (pp110)

Protein function

Tumor suppressor that is a key regulator of the G1/S transition of the cell cycle (PubMed:10499802). The hypophosphorylated form binds transcription regulators of the E2F family, preventing transcription of E2F-responsive genes (PubMed:10499802)

PDB

1AD6 , 1GH6 , 1GUX , 1H25 , 1N4M , 1O9K , 1PJM , 2AZE , 2QDJ , 2R7G , 3N5U , 3POM , 4CRI , 4ELJ , 4ELL , 9DGK , 9DHC , 9DHF , 9DHU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11934	DUF3452	109 → 228	Domain of unknown function (DUF3452)	Family
PF01858	RB_A	373 → 573	Retinoblastoma-associated protein A domain	Domain
PF01857	RB_B	646 → 765	Retinoblastoma-associated protein B domain	Domain
PF08934	Rb_C	768 → 925	Rb C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the retina. Expressed in foreskin keratinocytes (at protein level) (PubMed:20940255). {ECO:0000269|PubMed:20940255}.

Sequence

MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL
CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTEL
QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS
ISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYK
TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS
NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK
DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN
IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG
NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL
RLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK
FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS
PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG
TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKMNDSMDTSNKEEK

Sequence length

928

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance Cell cycle Cellular senescence Cushing syndrome Hepatitis C Hepatitis B Human cytomegalovirus infection Human papillomavirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Pathways in cancer Viral carcinogenesis Chemical carcinogenesis - receptor activation Pancreatic cancer Glioma Prostate cancer Melanoma Bladder cancer Chronic myeloid leukemia Small cell lung cancer Non-small cell lung cancer Breast cancer Hepatocellular carcinoma Gastric cancer		Inhibition of replication initiation of damaged DNA by RB1/E2F1 Condensation of Prophase Chromosomes Formation of Senescence-Associated Heterochromatin Foci (SAHF) Oncogene Induced Senescence Phosphorylation of proteins involved in G1/S transition by active Cyclin E:Cdk2 complexes Cyclin E associated events during G1/S transition Cyclin D associated events in G1 Cyclin A:Cdk2-associated events at S phase entry

5137

Show/Hide Causal Diseases (25)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Bone osteosarcoma	Pathogenic	rs587778842, rs587776783, rs3092891, rs137853293, rs137853294, rs587776789	RCV006257273 RCV000763334 RCV002496351 RCV005007842 RCV000763335 RCV004795405
Cervical cancer	Pathogenic	rs587778860	RCV005887887
Colon adenocarcinoma	Likely pathogenic	rs1566187856	RCV005901722
Diffuse pediatric-type high-grade glioma, H3-wildtype and IDH-wildtype	Pathogenic	rs587776780	RCV006254235
Gastric cancer	Likely pathogenic	rs2138136810	RCV005939471
Glioma susceptibility 1	Pathogenic	rs587776783, rs764754259, rs1555286503	RCV005887889 RCV005939472 RCV005901270
Hepatocellular carcinoma	Pathogenic	rs1555286250, rs587776789, rs1555286503	RCV005912637 RCV005899651 RCV005901271
Hereditary cancer-predisposing syndrome	Pathogenic; Likely pathogenic	rs1131690852, rs2138027218, rs2138084130, rs1131690881, rs483352690, rs2138342748, rs587776783, rs121913305, rs587778833, rs587778849, rs587778850, rs587778870, rs587778842, rs121913300, rs587778844 View all (193 more)	RCV004037680 RCV005712503 RCV002368232 RCV002456599 RCV006287160 RCV004656624 RCV004039991 RCV000492238 RCV004943753 RCV001014655 RCV004943754 RCV002326809 RCV000492345 RCV000492534 RCV000492203 RCV000492362 RCV000492557 RCV000492136 RCV000492246 RCV000492730 RCV000492118 RCV002343870 RCV006287533 RCV005724693 RCV004656781 RCV000587801 RCV006287557 RCV002352655 RCV002255896 RCV002345489 RCV005470378 RCV002320977 RCV002355333 RCV002347271 RCV002335830 RCV002344894 RCV002340048 RCV002344348 RCV002341017 RCV002369019 RCV002449614 RCV002421391 RCV002448019 RCV002382944 RCV002383283 RCV002383517 RCV002391836 RCV002389832 RCV002398430 RCV002387379 RCV002389341 RCV002405709 RCV002403635 RCV002414825 RCV002410229 RCV002410304 RCV002410376 RCV002396599 RCV002383678 RCV002381134 RCV002394583 RCV002392563 RCV002413055 RCV002422185 RCV002446170 RCV002413259 RCV002419958 RCV002430580 RCV002443957 RCV002430926 RCV002430998 RCV002426181 RCV002411038 RCV002417667 RCV002425862 RCV002448332 RCV004070143 RCV000492718 RCV004948795 RCV000492351 RCV003176997 RCV003176998 RCV003177001 RCV000492739 RCV003301740 RCV003301741 RCV003301755 RCV003301758 RCV003338937 RCV003338939 RCV002426500 RCV000492544 RCV000492108 RCV002399322 RCV000492492 RCV004948134 RCV000492684 RCV000492717 RCV002426501 RCV000492084 RCV000492635 RCV000492516 RCV000492204 RCV002408459 RCV005475407 RCV005725059 RCV004525252 RCV004525262 RCV004525269 RCV004525270 RCV004525294 RCV004525295 RCV004525296 RCV004525308 RCV006292537 RCV006276495 RCV006292538 RCV005475541 RCV005264546 RCV005475542 RCV005727168 RCV005475543 RCV000492335 RCV001013858 RCV002356696 RCV000492670 RCV000492677 RCV000492079 RCV000492515 RCV000492663 RCV000492357 RCV000492753 RCV000492283 RCV000492378 RCV000492579 RCV000492187 RCV000492301 RCV000492145 RCV000492586 RCV000492616 RCV000492150 RCV000492213 RCV000492454 RCV000492370 RCV000492470 RCV000492073 RCV000492621 RCV000492229 RCV000492435 RCV000492252 RCV000492562 RCV000492399 RCV000492405 RCV000492155 RCV000492654 RCV000492694 RCV000492095 RCV000492263 RCV000492602 RCV000492316 RCV000492572 RCV000492690 RCV000492255 RCV000492277 RCV000492660 RCV000492415 RCV000492212 RCV000492526 RCV000492490 RCV000492554 RCV000492392 RCV000492573 RCV000492294 RCV000492261 RCV000492541 RCV000492194 RCV000492517 RCV000492235 RCV000492308 RCV000492192 RCV000492076 RCV000492423 RCV000492272 RCV000492425 RCV000492437 RCV000492376 RCV000492727 RCV000492451 RCV000492105 RCV000492322 RCV000492166 RCV000492309 RCV000492755 RCV000492188 RCV000492539 RCV000492748 RCV000492489 RCV000492732 RCV000492728 RCV000492733 RCV000574308 RCV000589929 RCV000587932 RCV000586996 RCV000589809 RCV005470490 RCV001024025 RCV002397438 RCV005470495 RCV001020949 RCV005470508 RCV002397558 RCV002397604 RCV006287322 RCV001010236 RCV001011110 RCV001015294 RCV001011288 RCV002393296 RCV004950207 RCV002402800 RCV002393689 RCV002379981 RCV004944961 RCV002375336 RCV000492734
Hereditary retinoblastoma	Pathogenic; Likely pathogenic	rs2138112509, rs2542206886, rs137853296, rs1131690858	RCV002466773 RCV002466926 RCV002466401 RCV002466520
Lip and oral cavity carcinoma	Pathogenic	rs1949384455	RCV001255642
Lung adenocarcinoma	Pathogenic	rs2542156330	RCV003129627
Lung cancer	Likely pathogenic; Pathogenic	rs587776783, rs1131690860	RCV005920559 RCV005901273
Lynch syndrome 4	Pathogenic; Likely pathogenic	rs587776789, rs750136284	RCV000786882 RCV000786881
Malignant glioma	Pathogenic	rs587778862	RCV006254386
Malignant tumor of urinary bladder	Pathogenic; Likely pathogenic	rs587778860, rs587778839, rs587778842, rs587776783, rs121913302, rs121913303, rs587778863, rs2138034427, rs1952480014, rs2138335833, rs2138327439, rs1226865525, rs3092891, rs137853293, rs1593538130 View all (10 more)	RCV005887886 RCV005887888 RCV006257273 RCV000763334 RCV003332117 RCV003332118 RCV003332119 RCV003332367 RCV002249148 RCV002250288 RCV005931921 RCV003332968 RCV005931178 RCV002496351 RCV005007842 RCV000013952 RCV000763335 RCV004795405 RCV005939470 RCV005899756 RCV005899754 RCV005899757 RCV005899755 RCV005869509 RCV004569371 RCV003332236
Neoplasm	Pathogenic; Likely pathogenic	rs2138136261, rs587778833, rs587778867, rs587778868, rs587778850, rs587778825, rs587778842, rs587778855, rs587776783, rs121913302, rs2138130852, rs1948523741, rs2138033820, rs886043247, rs121913301 View all (6 more)	RCV004671380 RCV004668775 RCV004668776 RCV006273510 RCV004668777 RCV004668778 RCV006273511 RCV006273512 RCV005229900 RCV006273513 RCV004671457 RCV006274355 RCV004673777 RCV006273698 RCV004668727 RCV006273053 RCV004674019 RCV004674020 RCV004669004 RCV006273839 RCV004671208
RB1-related disorder	Pathogenic; Likely pathogenic	rs587776783, rs1131690886, rs2138346270, rs1131690847, rs1131690846, rs1566186125	RCV003410355 RCV003949104 RCV003976775 RCV003419826 RCV003403138 RCV003983181
Retinoblastoma	Likely pathogenic; Pathogenic	rs1948534047, rs2138123098, rs2138136810, rs2138025968, rs2138116702, rs2138131298, rs1131690852, rs2138027218, rs2138027345, rs1469887040, rs2138027798, rs2138034131, rs1131690907, rs2138084130, rs2138087163 View all (588 more)	RCV001340617 RCV001374399 RCV001374400 RCV001378016 RCV001377729 RCV001378940 RCV001386153 RCV001382439 RCV001387149 RCV001386154 RCV001385813 RCV001389644 RCV001386155 RCV001390007 RCV001386157 RCV001383396 RCV001380247 RCV001388712 RCV001380199 RCV001380970 RCV001380999 RCV001383898 RCV001383900 RCV001383901 RCV001382159 RCV001387219 RCV001383899 RCV001380940 RCV001389511 RCV001389509 RCV001390325 RCV001381396 RCV001387265 RCV001387462 RCV001384072 RCV001384073 RCV001390327 RCV001854505 RCV001533518 RCV001533519 RCV001533520 RCV001533521 RCV001533522 RCV001533523 RCV001533524 RCV001533525 RCV001533526 RCV001533527 RCV001543670 RCV004821312 RCV004556842 RCV005095189 RCV000114676 RCV000114677 RCV000114678 RCV000114680 RCV000114681 RCV000114682 RCV000114683 RCV000114684 RCV000114686 RCV000114687 RCV000114688 RCV000114689 RCV000114690 RCV000114691 RCV000114692 RCV000114693 RCV000114694 RCV000114695 RCV000114696 RCV000114697 RCV000114698 RCV000114699 RCV000114701 RCV000114702 RCV000114703 RCV000114704 RCV000114705 RCV000114706 RCV000114710 RCV000114711 RCV000114712 RCV000114713 RCV000114714 RCV000114715 RCV000114716 RCV000114717 RCV000114718 RCV000114719 RCV000114720 RCV000114722 RCV000114723 RCV001805738 RCV000114724 RCV000114725 RCV000114726 RCV000114727 RCV000114728 RCV000114729 RCV000114731 RCV000114733 RCV000114735 RCV000114736 RCV000114737 RCV000114738 RCV000114739 RCV001809313 RCV001918957 RCV001924110 RCV001941800 RCV001904009 RCV001894504 RCV001872293 RCV001938303 RCV001950933 RCV001946774 RCV001949294 RCV001953851 RCV001953895 RCV001997090 RCV002012144 RCV001949654 RCV001905470 RCV001989795 RCV001920131 RCV001919410 RCV001898449 RCV002035377 RCV002000209 RCV002002434 RCV002002437 RCV002002440 RCV002037927 RCV000128456 RCV000128457 RCV002037779 RCV001941856 RCV001939588 RCV001994876 RCV001939372 RCV001948221 RCV001956389 RCV001886991 RCV001947025 RCV001959117 RCV001959126 RCV002044891 RCV001910839 RCV002005116 RCV002011891 RCV004556848 RCV002272620 RCV002272670 RCV002272784 RCV002287299 RCV004557049 RCV001850106 RCV004556852 RCV003138241 RCV004556857 RCV004556856 RCV004556858 RCV004556859 RCV004556855 RCV004556853 RCV004556854 RCV003101027 RCV004556860 RCV004556861 RCV003514591 RCV003062580 RCV003062581 RCV003062582 RCV003062584 RCV003058414 RCV003058415 RCV003062586 RCV003041190 RCV003041191 RCV001388989 RCV001386156 RCV002818981 RCV002819746 RCV002829085 RCV002856232 RCV002811691 RCV002857077 RCV002847580 RCV002848186 RCV002852118 RCV002876067 RCV002867382 RCV002877174 RCV003009571 RCV003019803 RCV003049513 RCV003027945 RCV003043986 RCV003048280 RCV000226485 RCV000227413 RCV000234228 RCV004556864 RCV004556865 RCV000312051 RCV001855163 RCV004556777 RCV004556868 RCV003485927 RCV004556870 RCV003397009 RCV003337752 RCV000013944 RCV000013945 RCV000013946 RCV000013947 RCV000013948 RCV000013949 RCV000013950 RCV000013951 RCV001229630 RCV002272016 RCV000013956 RCV000013957 RCV000013958 RCV000013959 RCV000013960 RCV000013961 RCV000013962 RCV000013963 RCV000013964 RCV000114734 RCV000013967 RCV000013968 RCV000013969 RCV000013970 RCV000013971 RCV000013972 RCV003444436 RCV003515312 RCV003515317 RCV003515319 RCV003514662 RCV003515437 RCV003514127 RCV003516227 RCV003514089 RCV003514161 RCV003516364 RCV003516342 RCV003516343 RCV003516344 RCV003516345 RCV003516346 RCV003516347 RCV003516349 RCV003516350 RCV003516351 RCV003516352 RCV003516353 RCV003516354 RCV003516355 RCV003516356 RCV003516357 RCV003516358 RCV003516359 RCV003516622 RCV003514943 RCV003514927 RCV003514979 RCV003514982 RCV003515071 RCV003515029 RCV003515858 RCV003515931 RCV003626929 RCV003627703 RCV003627786 RCV003627813 RCV003628047 RCV003628048 RCV003628185 RCV003628415 RCV003628392 RCV003628242 RCV003628587 RCV003626103 RCV003626154 RCV003626227 RCV003626253 RCV003626274 RCV003627414 RCV003628102 RCV003859946 RCV004556882 RCV004556883 RCV004555384 RCV004557000 RCV004557001 RCV004557002 RCV004557003 RCV004557004 RCV004557005 RCV004557006 RCV004557007 RCV004557008 RCV004557009 RCV004557012 RCV004557013 RCV004557014 RCV004557015 RCV004557016 RCV004557017 RCV004557018 RCV004557019 RCV004557020 RCV004557021 RCV004557022 RCV004557023 RCV004557024 RCV004557025 RCV004557026 RCV004557027 RCV004557028 RCV004557029 RCV004557030 RCV004557031 RCV004557032 RCV004557033 RCV004557036 RCV004557037 RCV004557038 RCV004557040 RCV004557041 RCV004557042 RCV004557043 RCV004557044 RCV004557045 RCV004557046 RCV004557047 RCV004557048 RCV004557050 RCV004557051 RCV004557052 RCV004557053 RCV004557055 RCV004557056 RCV004557057 RCV004557058 RCV004557059 RCV004557060 RCV004557061 RCV004557062 RCV004557063 RCV004557064 RCV004557065 RCV004557066 RCV004557067 RCV004557068 RCV004557069 RCV004557072 RCV004557073 RCV004557074 RCV004557075 RCV004557076 RCV004557078 RCV004557079 RCV004557080 RCV004557081 RCV004557082 RCV004557083 RCV004557084 RCV004557086 RCV004557088 RCV004557089 RCV004557090 RCV004557091 RCV004557092 RCV004557093 RCV004557094 RCV004557097 RCV004557098 RCV004557099 RCV004557101 RCV004557102 RCV004557103 RCV004557104 RCV004557105 RCV004557107 RCV004557109 RCV004557110 RCV004557111 RCV004557112 RCV004557113 RCV004557114 RCV004557115 RCV004557116 RCV004557117 RCV004557118 RCV004557119 RCV004557120 RCV004557121 RCV004557123 RCV004557124 RCV004557125 RCV004557128 RCV004557129 RCV004557130 RCV004557131 RCV004557133 RCV004557135 RCV004557136 RCV004557137 RCV004557138 RCV004557139 RCV004557140 RCV004557141 RCV004557142 RCV004557143 RCV004557144 RCV004557145 RCV004557146 RCV004557147 RCV004557148 RCV004557149 RCV004557150 RCV004557151 RCV004557152 RCV004557153 RCV004557154 RCV004557155 RCV004557156 RCV004557157 RCV004557158 RCV004557159 RCV004557161 RCV004557162 RCV004557163 RCV004557165 RCV004557166 RCV004557167 RCV004557168 RCV004557169 RCV004557170 RCV004557171 RCV004557172 RCV004557173 RCV004557174 RCV004557175 RCV004557176 RCV004557177 RCV004557178 RCV004557180 RCV004557181 RCV004557182 RCV004557183 RCV004557184 RCV004557185 RCV004557186 RCV004557187 RCV004557188 RCV004557189 RCV004557190 RCV004557192 RCV004557193 RCV004557195 RCV004557196 RCV004557197 RCV004557198 RCV004557199 RCV004557200 RCV004557201 RCV004557202 RCV004557203 RCV004557204 RCV004557205 RCV004557206 RCV004557207 RCV004557208 RCV004557209 RCV004557210 RCV004557211 RCV004557212 RCV004557213 RCV004557214 RCV004557215 RCV004557216 RCV004557217 RCV004557218 RCV004557219 RCV004557221 RCV004557222 RCV004557223 RCV004557224 RCV004577633 RCV000437633 RCV000471747 RCV000470261 RCV000476967 RCV000471628 RCV000456907 RCV000466407 RCV000469761 RCV000462245 RCV000465314 RCV000462003 RCV000471380 RCV002525820 RCV004556796 RCV000795397 RCV000697493 RCV001856950 RCV004556798 RCV000814584 RCV001290126 RCV002523986 RCV001042526 RCV000812389 RCV003514369 RCV000548468 RCV004556792 RCV000684899 RCV000699793 RCV000701287 RCV004556797 RCV005091032 RCV000698759 RCV003514368 RCV001382143 RCV004556799 RCV004556794 RCV000722018 RCV002523442 RCV000705417 RCV001856949 RCV004556793 RCV003514370 RCV001228827 RCV004820851 RCV000686279 RCV001202042 RCV001384071 RCV000555963 RCV000535718 RCV000541021 RCV000539506 RCV000532339 RCV000553322 RCV000543344 RCV004556806 RCV000632925 RCV001237743 RCV000626660 RCV000632934 RCV000632961 RCV000632942 RCV000632933 RCV000632937 RCV000632932 RCV000632959 RCV000632946 RCV000632924 RCV000632960 RCV000632938 RCV000632966 RCV000689697 RCV000699038 RCV000697676 RCV000695245 RCV000702435 RCV000699397 RCV000695277 RCV000693604 RCV000693421 RCV000702285 RCV000687155 RCV000687725 RCV000703743 RCV000690735 RCV000705554 RCV000693455 RCV000704628 RCV000704145 RCV000684936 RCV000686416 RCV000697663 RCV000707506 RCV000706340 RCV000722027 RCV000722028 RCV000722024 RCV000722030 RCV003230274 RCV002466580 RCV000786933 RCV000786934 RCV000816353 RCV000816071 RCV000810383 RCV000793959 RCV000806858 RCV000820318 RCV000809364 RCV000799793 RCV000793292 RCV000816000 RCV000814656 RCV000803123 RCV000807700 RCV000799512 RCV000808999 RCV000793849 RCV000801885 RCV000819160 RCV000811806 RCV000801998 RCV000794583 RCV000804002 RCV000799100 RCV000801676 RCV000989105 RCV000989109 RCV000989111 RCV000989117 RCV000989138 RCV001788396 RCV001523800 RCV003514452 RCV001048241 RCV001039105 RCV001035710 RCV001066074 RCV001038726 RCV001061444 RCV001053080 RCV001060697 RCV001050879 RCV001067330 RCV001053360 RCV001066595 RCV001064630 RCV001037141 RCV001064923 RCV001069328 RCV001056968 RCV001057987 RCV001051823 RCV001196348 RCV001196939 RCV001196146 RCV001219872 RCV001214854 RCV001214682 RCV001214983 RCV001204113 RCV001211166 RCV001206314 RCV001213175 RCV001221434 RCV001231370 RCV001231903 RCV001226539 RCV001233849 RCV001240257 RCV001243830 RCV001257127 RCV001257129 RCV001257128 RCV001257130 RCV001290127 RCV001290128 RCV001290129 RCV001523843 RCV001523798 RCV001523799 RCV001523842 RCV001523805 RCV001523795 RCV001523841 RCV001523796 RCV001523797 RCV001523845 RCV001523846 RCV001523844 RCV001523802 RCV001523804 RCV001523801 RCV001292823 RCV001294162 RCV000114730 RCV001301388
Sarcoma	Pathogenic	rs587776783, rs1593538236, rs1949420231, rs2138359672, rs1060503087, rs2138116708	RCV005887890 RCV005925359 RCV005924368 RCV005930199 RCV005931898 RCV005899496 RCV005910914
See cases	Pathogenic	rs121913302	RCV003156072
Small cell lung carcinoma	Pathogenic	rs587778842, rs587776783, rs3092891, rs137853293, rs121913297, rs137853294, rs587776789	RCV006257273 RCV000763334 RCV002496351 RCV005007842 RCV000013953 RCV000763335 RCV004795405
Squamous cell carcinoma	Pathogenic	rs2138131143	RCV003129605
Squamous cell lung carcinoma	Pathogenic	rs764754259	RCV005895771
Trilateral retinoblastoma	Pathogenic	rs121913304	RCV000013966
Vulvar adenocarcinoma of mammary gland type	Pathogenic	rs137853294	RCV004813036

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign; Likely benign	rs372815788, rs80122842, rs776987458, rs781419356	RCV005924763 RCV005923677 RCV005924942 RCV005899924
B lymphoblastic leukemia lymphoma with t(12;21)(p13;q22); TEL-AML1 (ETV6-RUNX1)	Uncertain significance	rs1566240940	RCV000761115
B Lymphoblastic Leukemia/Lymphoma, Not Otherwise Specified	Conflicting classifications of pathogenicity	rs149359120	RCV000761059
Cholangiocarcinoma	Benign	rs9535023	RCV005888451
Clear cell carcinoma of kidney	Benign	rs9535023	RCV005888445
Colorectal cancer	Benign; Likely benign	rs762805947	RCV005869295
Familial cancer of breast	Benign; Likely benign	rs80122842, rs762805947	RCV005923676 RCV005869294
Hereditary cancer	Uncertain significance	rs1593529910	RCV003492200
Malignant lymphoma, large B-cell, diffuse	Benign	rs9535023	RCV005888446
Malignant tumor of esophagus	Uncertain significance	rs794727138	RCV005889778
Medulloblastoma	Conflicting classifications of pathogenicity	rs754507551	RCV000761011
Melanoma	Uncertain significance	rs121913302	RCV005937409
Optic atrophy	Uncertain significance	rs2542188451	RCV004817024
Ovarian cancer	Conflicting classifications of pathogenicity; Benign; Likely benign	rs587778640, rs2138144909, rs1464633359, rs201458896, rs375751988, rs142509759	RCV003153399 RCV003154233 RCV003154718 RCV003153636 RCV003153682 RCV003153323
Ovarian neoplasm	Conflicting classifications of pathogenicity	rs149800437	RCV001262454
Ovarian serous cystadenocarcinoma	Benign; Likely benign	rs9535023, rs146897002	RCV005888448 RCV005895190
Retinal dystrophy	Uncertain significance	rs1349657979, rs267603841	RCV004818195 RCV004814995
Thymoma	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	rs372815788, rs80122842, rs9535023, rs200658795, rs2138026917	RCV005924765 RCV005923679 RCV005888450 RCV005891242 RCV005931528
Thyroid cancer, nonmedullary, 1	Uncertain significance; Conflicting classifications of pathogenicity	rs1593456939, rs374523971	RCV005902001 RCV005907053
Uterine carcinosarcoma	Benign	rs9535023, rs3092904	RCV005888449 RCV005886209
Uterine corpus endometrial carcinoma	Benign	rs9535023	RCV005888452

Show/Hide Text Mining Associations (377)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
13q deletion syndrome	Associate	34573300
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	23223137, 26655088, 36075957
Adenocarcinoma	Associate	32460015, 34627261, 34674268, 35016432, 36573306, 37628903, 37967200
Adenocarcinoma Mucinous	Associate	17649817
Adenocarcinoma of Lung	Associate	18948947, 21151896, 25758528, 26066407, 29525983, 31292388, 31959344, 32616892, 32931935, 35016432, 35367201, 36583000, 36810856, 37520249
Adenoma Pleomorphic	Associate	21196892, 23900873
Adrenocortical Adenoma	Associate	33564960
Adrenocortical Carcinoma	Associate	25078331, 25490274, 29581542, 33564960
Allan Herndon Dudley syndrome	Associate	26195723
Anaplasia	Associate	32139107
Aneuploidy	Associate	19052088, 1911187, 19883508, 20003272, 28723239, 32057913, 34303217
Angina Unstable	Associate	35437049
Angiomyolipoma	Associate	36308711
Anus Neoplasms	Associate	24048785
Aortic Valve Disease	Associate	23595191
Arthritis Rheumatoid	Associate	14730602, 30352835
Arthritis Rheumatoid	Inhibit	37506143
Astrocytoma	Associate	10079373, 12556968, 15367334, 15970925, 26317630, 31736278, 35945679
Ataxia	Associate	34130600
Ataxia Telangiectasia	Associate	32345961, 37345209
Atherosclerosis	Associate	36303246
Atresia of small intestine	Associate	39742876
Biliary Tract Diseases	Associate	40138743
Body Dysmorphic Disorders	Associate	22909775
Bone Marrow Diseases	Associate	33369444
Brain Diseases	Associate	34130600
Brain Neoplasms	Associate	17311305, 18575738, 22205104, 27556418, 32345147, 32373934, 37140883
Branchioma	Associate	37401932
Breast Neoplasms	Associate	10193322, 10193332, 11267940, 11506494, 11717311, 11976406, 12021276, 12838314, 14572667, 15220371, 16457699, 16685266, 16966377, 17047088, 17074804 View all (71 more)
Breast Neoplasms	Inhibit	2217208
Breast Neoplasms Male	Associate	33964913
Burkitt Lymphoma	Associate	10360642, 10482541, 10702389, 19694314, 36719239
Calcinosis Cutis	Inhibit	21099103
Calcinosis Cutis	Associate	36308711
Carcinogenesis	Associate	11079730, 11369633, 11965548, 12657136, 12912919, 12940460, 1316611, 1352883, 14695761, 15927959, 1648218, 17461478, 18475256, 1911187, 21816898 View all (16 more)
Carcinogenesis	Inhibit	34851822
Carcinoid Tumor	Associate	26008974, 31085341, 33144445, 9033254
Carcinoma	Associate	26429873, 31467233
Carcinoma	Inhibit	28887603, 33980253
Carcinoma Adenosquamous	Associate	17649814
Carcinoma Basal Cell	Inhibit	18782450
Carcinoma Ductal	Associate	11267940, 35743985
Carcinoma Endometrioid	Associate	10682682, 12515910, 24684970
Carcinoma Hepatocellular	Associate	11531255, 1339101, 16254459, 17278226, 17907805, 18281783, 24254306, 26576645, 26823834, 27246981, 27849562, 28300839, 29085029, 30531861, 35581624 View all (5 more)
Carcinoma Hepatocellular	Inhibit	24935581
Carcinoma in Situ	Inhibit	16402033
Carcinoma in Situ	Stimulate	40362654
Carcinoma Intraductal Noninfiltrating	Associate	21756866, 23197489
Carcinoma Large Cell	Associate	26960398, 28535939, 29535388, 31085341, 33144445, 35331190
Carcinoma Lobular	Stimulate	35743985
Carcinoma Merkel Cell	Associate	19551862, 24406863, 26238782, 26743471, 26981779, 27121059, 34480892, 34593967, 36075957, 36736454
Carcinoma Neuroendocrine	Associate	30627226, 33563892, 34245124, 34247193, 34326338, 34647903, 35016432, 35367201, 35596001, 36653904, 36807750, 37345605
Carcinoma Neuroendocrine	Stimulate	34401980
Carcinoma Non Small Cell Lung	Associate	10376986, 10574258, 10965496, 11474135, 24200043, 26647789, 26960398, 30773851, 31774910, 34396834, 35598205, 35747993, 35792876, 35815661, 36282125 View all (5 more)
Carcinoma Ovarian Epithelial	Associate	11076658, 18431743, 26043844, 33676525
Carcinoma Pancreatic Ductal	Associate	15865092, 24293293, 30535494
Carcinoma Renal Cell	Associate	29353061, 34980126, 37515929, 37629167, 38043790, 38492778, 39336758
Carcinoma Small Cell	Associate	24323898, 26340530, 28535939, 28951314, 29763719, 31228622, 31959344, 32389660, 32649013, 33031101, 34145257, 35662501, 36082904, 37628903, 38057798, 8180008 View all (1 more)
Carcinoma Small Cell	Inhibit	28106103, 30918106
Carcinoma Squamous Cell	Associate	11267938, 11737469, 17461478, 24323028, 28177435, 30446465, 31829519, 31959344, 34480892, 36075957, 37821306, 39481992
Carcinoma Squamous Cell	Inhibit	28106103
Carcinoma Transitional Cell	Associate	15161057, 17311305
Carcinosarcoma	Associate	32209061
Cardiomyopathy infantile histiocytoid	Associate	40277780
Cell Transformation Neoplastic	Associate	23707559
Cell Transformation Viral	Associate	22529291
Chediak Higashi Syndrome	Associate	34130600
Cholangiocarcinoma	Associate	8957064
Choline Deficiency	Inhibit	15147518
Chondrosarcoma	Associate	11332612, 18624751
Chordoma	Associate	16078265
Chromosomal Instability	Associate	24613344, 39227622
Chromosome 12 12p trisomy	Inhibit	18702872
Chromosome 12 12p trisomy	Associate	9753065
Chromosome Aberrations	Inhibit	18702872
Chromosome Disorders	Associate	17201183, 19252413, 20003272, 36124964
Chromothripsis	Associate	27741277
Colitis Ulcerative	Associate	34733451
Colorectal Neoplasms	Associate	11106567, 11207048, 18794899, 1911187, 19125701, 22020530, 23059827, 27321817, 28675510, 32123008, 34476575, 36296971, 39742876, 7779716, 7947085, 9369933 View all (1 more)
Compassion Fatigue	Associate	25135958
Congenital Abnormalities	Associate	40138429
Congenital disorder of glycosylation type 1B	Associate	23197489
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	34130600
Constipation	Associate	21505449
COVID 19	Associate	34058265
Death	Inhibit	18236071
Death	Associate	21203526, 23462184
Dendritic Cell Sarcoma Follicular	Associate	28621320, 37994105
Desmoid disease hereditary	Associate	17077595
Diabetes Mellitus	Associate	33490239
Diabetes Mellitus Type 1	Associate	10504475
Diabetes Mellitus Type 2	Associate	37049846
Disease	Associate	11267940, 2380395
Down Syndrome	Associate	21538823
Drug Related Side Effects and Adverse Reactions	Associate	27600289
Dysmenorrhea	Associate	26006736
Dystonic Disorders	Associate	32139107
Edema	Associate	26337765
Endocrine System Diseases	Associate	29443735, 36332363
Endometrial Hyperplasia	Associate	25495249, 34162378
Endometrial Neoplasms	Associate	10682682, 12515910, 15589577, 17649817, 21760855, 21816898, 22295114, 24531693, 29264761, 30816518, 33464989, 34162378, 35717540, 39577664
Endometriosis	Associate	16009159, 16616093, 18048499, 25217304, 33464989
Endometriosis	Inhibit	27593876
Ependymoma	Associate	12556968
Epstein Barr Virus Infections	Associate	25550786
Esophageal atresia with or without tracheoesophageal fistula	Associate	27246981
Esophageal Neoplasms	Associate	11079730, 11315260, 17461478, 32058552, 32104700, 34663841, 8415648
Esophageal Squamous Cell Carcinoma	Associate	11079730, 11570573, 11599796, 17461478, 22938432, 29866946, 34663841
Esophagitis	Associate	17461478
Eye Diseases	Associate	34336010
Eye Neoplasms	Associate	18073428
Familial cylindromatosis	Associate	26336083
Fanconi Anemia	Associate	26928463
Farber Lipogranulomatosis	Associate	31085341
Fetal Growth Retardation	Associate	20008130
Fever	Associate	8950161
Fibroadenoma	Associate	33727697
Fibrolamellar hepatocellular carcinoma	Associate	28486549
Frontotemporal Dementia	Associate	34130600
Frontotemporal Lobar Degeneration	Associate	22623979
Gallbladder Neoplasms	Stimulate	33563892
Gallbladder Neoplasms	Associate	34798839
Gastro enteropancreatic neuroendocrine tumor	Associate	26684240, 34647903
Gastrointestinal Neoplasms	Associate	37345605
Gastrointestinal Stromal Tumors	Associate	31553483, 31570771, 31758409
GATA2 Deficiency	Associate	12925224
Gaucher Disease	Associate	34130600
Genetic Diseases Inborn	Associate	22874878, 28780672
Genomic Instability	Inhibit	18723266
Gerstmann Straussler Scheinker Disease	Associate	34130600
Gilbert Disease	Associate	27096027
Glioblastoma	Associate	10079373, 11204276, 12556968, 20406234, 22157621, 23468990, 23707559, 23864165, 26337765, 27344175, 27502248, 30151703, 30816530, 30861589, 31896544 View all (6 more)
Glioma	Associate	11278920, 21470325, 21663659, 24077277, 30816530, 32665022, 40355925, 8286200
Glycogen Storage Disease	Associate	34130600
Head and Neck Neoplasms	Associate	16948516, 27507850, 34635145
Hearing Loss Bilateral	Associate	34336010
Hearing Loss Unilateral	Associate	31997559
Heart Valve Diseases	Associate	23595191
Hemangioblastoma	Associate	26768750
Hemangioendothelioma	Associate	24433316
Hemangioendothelioma Epithelioid	Associate	31577358
Hepatitis B	Inhibit	18782450
Hepatitis B	Associate	26339389
Hepatoblastoma	Associate	24373183
Hepatoblastoma	Inhibit	24935581
Hepatolenticular Degeneration	Associate	8234264
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30394935
Histiocytoma Malignant Fibrous	Associate	17094467
HIV Infections	Associate	22701041
Hodgkin Disease	Associate	25550786
Humoral Hypercalcemia Of Malignancy	Associate	38040321
Huntington Disease	Associate	34130600
Hydrocephalus	Associate	23900873
Hyperaldosteronism	Associate	15136974
Hyperoxia	Associate	18948382
Hyperparathyroidism Primary	Associate	27760455
Hyperplasia	Associate	26537237
Hypoxia	Associate	14710850, 15377335, 31834445, 8763866, 9528826, 9862563
Hypoxia Brain	Associate	10471034, 15377335
Immunologic Deficiency Syndromes	Inhibit	25377796
Immunologic Deficiency Syndromes	Associate	33760207
Infections	Inhibit	10662629
Infections	Associate	1316611, 14730602, 36719239
Inflammation	Associate	18048499, 37506143
Inflammation	Inhibit	23835558, 32377712, 37049846
Inflammatory Breast Neoplasms	Associate	28271309
Insulin Resistance	Associate	23315497
Insulin Resistance	Inhibit	37049846
Intellectual Disability	Associate	31806026
Intestinal Diseases	Associate	14695761, 27629734
Intracranial Embolism	Associate	33755733
Intraocular Lymphoma	Associate	29579639, 36291051
Kidney Calculi	Associate	15161057
Kidney Diseases	Associate	10504475
Kidney Neoplasms	Associate	37310408
Laminopathies	Associate	17274801
Laron Syndrome	Associate	27336726
Laryngeal Neoplasms	Associate	19141402
Leber Congenital Amaurosis	Associate	30312872
Leigh Disease	Associate	35662501
Leiomyoma	Associate	12413982, 19499404, 25625804, 26006736, 28664937, 31313594, 34224241
Leiomyosarcoma	Stimulate	19077296
Leiomyosarcoma	Associate	2765366, 27882721, 29270859, 29321523, 29327710, 29662154, 32299819, 33115433, 33788262
Leiomyosarcoma	Inhibit	37491255
Leukemia	Associate	10477726, 15178346, 1993222, 2242427, 2404525, 24987858
Leukemia B Cell	Associate	18702872
Leukemia Biphenotypic Acute	Associate	23900870
Leukemia Lymphocytic Chronic B Cell	Associate	11529851, 15057823, 18702872, 1993222, 21890456, 26043844, 7655020, 8378351, 8781411, 9454769, 9599022
Leukemia Lymphocytic Chronic B Cell	Inhibit	12010815
Leukemia Lymphoid	Associate	8471770
Leukemia Megakaryoblastic Acute	Associate	21538823
Leukemia Myeloid	Associate	10210318
Leukemia Myeloid Acute	Inhibit	11698483
Leukemia Myeloid Acute	Associate	1683797, 21643017, 30926971, 8813093
Leukemia Plasma Cell	Associate	22529291
Leukemia Prolymphocytic T Cell	Associate	11529851, 9753065
Leukemia Promyelocytic Acute	Associate	34042274
Leukemia T Cell	Associate	11041200
Lichen Sclerosus et Atrophicus	Associate	11737469
Lipoblastoma	Inhibit	29976943
Lipoblastoma	Associate	37307874
Lipoma	Associate	15136974, 26945059
Liposarcoma	Associate	15933756, 35672466, 7479800
Liposarcoma Myxoid	Associate	34168281
Lung Diseases	Associate	40138743
Lung Neoplasms	Associate	19472407, 25219825, 26647789, 27873319, 30773851, 31228622, 31340547, 33407425, 34308964, 9192978
Lymphatic Metastasis	Associate	17384651, 35711885, 37520249
Lymphatic Metastasis	Stimulate	8950161
Lymphoma	Associate	11027429, 12556968, 1993222, 9136918
Lymphoma B Cell	Associate	10323217, 10360642, 32345961
Lymphoma Large B Cell Diffuse	Associate	21693768, 31327185
Lymphoma Large Cell Anaplastic	Stimulate	16614728
Lymphoma Mantle Cell	Associate	12683869, 17332242, 18984860, 19594747, 1993222, 24682267, 26022239, 28059098, 8623927
Lymphoma Non Hodgkin	Associate	10360642, 11027429, 11529851, 19383911, 26043844, 27049262, 33063942, 9136918
Lymphoma T Cell Cutaneous	Associate	16614728
Malformations of Cortical Development Group I	Associate	24809452
Malignant mesenchymal tumor	Associate	32889887, 3480530
Medulloblastoma	Associate	11577176, 12556968
Melanoma	Associate	10727462, 15803180, 16645588, 17218782, 17916908, 27776349, 28526299, 31980996, 8611425, 9862563
Melanoma	Inhibit	33670958
Melanoma Cutaneous Malignant	Associate	10732752
Metrorrhagia	Associate	26006736
Mixed Tumor Malignant	Associate	37285266
Mouth Diseases	Associate	34983823
Mouth Neoplasms	Associate	21781453, 26459309
Multiple Myeloma	Associate	10706856, 10979940, 11278272, 11529851, 19135901, 24987674, 26474569, 28234347, 32345147, 8822942, 9207463
Mycosis Fungoides	Inhibit	16614728
Mycosis Fungoides	Associate	18832135
Myelodysplastic Syndromes	Associate	10848828, 27741277
Myelodysplastic Syndromes	Inhibit	16213365
Myelolipoma	Associate	15136974
Myeloproliferative Disorders	Associate	18723266
Myoepithelioma	Associate	28390395
Myxoma	Associate	22011900
Nasopharyngeal Carcinoma	Associate	32013999, 32862607
Neoplasm Metastasis	Associate	11079730, 12556968, 15655836, 20664703, 27835695, 29615433, 30833416, 31525487, 31685261, 32013999, 32493230, 33122107, 34183353, 34499237, 34799997 View all (7 more)
Neoplasm Metastasis	Inhibit	32657779, 39481992
Neoplasm Recurrence Local	Associate	34326338
Neoplasms	Associate	10323217, 10360642, 10376969, 10574258, 10702389, 10779361, 10804285, 10825186, 10965496, 11079730, 11106567, 11207046, 11294829, 11474135, 11520274 View all (339 more)
Neoplasms	Inhibit	10880954, 10982822, 11287602, 11315260, 11529851, 11531255, 11577176, 12181248, 12391156, 12442903, 12482990, 12657136, 12769842, 12912919, 12947006 View all (168 more)
Neoplasms Basal Cell	Associate	33258708
Neoplasms Cystic Mucinous and Serous	Associate	19679296, 24336157, 26043110, 37511582
Neoplasms Germ Cell and Embryonal	Associate	25522918
Neoplasms Glandular and Epithelial	Associate	19679296, 24336157
Neoplasms Radiation Induced	Associate	36788076
Neoplasms Second Primary	Associate	35382685
Neoplasms Squamous Cell	Associate	15132777, 19924135, 25115387, 25684524, 33687433
Neoplastic Cells Circulating	Associate	33761970
Neoplastic Syndromes Hereditary	Associate	31568710, 33827469, 34171053
Nerve Degeneration	Associate	15741232
Nervous System Neoplasms	Associate	12556968
Neuroblastoma	Associate	18413728, 20577596, 23892435, 25377796, 31429199, 34893606, 36982482, 39217334
Neuroendocrine Tumors	Associate	23127113, 25273089, 28991877, 31587305, 32094488, 33144445, 33522043, 34627261, 35440132, 35609408, 36044718, 37725435, 9033254
Neuroendocrine Tumors	Inhibit	33031101
Neurofibrosarcoma	Associate	12556968, 18413802, 19414372, 34065204
Neuronal Ceroid Lipofuscinoses	Associate	34130600
Nevus Pigmented	Associate	17578512
Niemann Pick Disease Type A	Associate	34130600
Non Muscle Invasive Bladder Neoplasms	Associate	26238431, 32165095, 33388091, 33879103, 34177933, 34953602, 35073341, 40215668, 9436977
Obesity	Inhibit	23315497, 32377712
Obesity	Associate	37049846
Oligodendroglioma	Associate	25608559
Oral Submucous Fibrosis	Associate	38050610
Oropharyngeal Neoplasms	Associate	30189895
Osteosarcoma	Associate	10817503, 11152455, 11418138, 14679136, 14728297, 1673287, 20465837, 20851996, 22006429, 24703847, 24835790, 26787232, 27124644, 27352193, 2740342 View all (11 more)
Osteosarcoma	Inhibit	9192669
Ovarian Diseases	Associate	18507046, 31792669, 31878927
Ovarian Diseases	Inhibit	27593876
Ovarian Neoplasms	Associate	11076658, 12149147, 15028555, 17047088, 17242700, 18431743, 18507046, 21278246, 21908773, 23176303, 23574718, 24336157, 25803614, 26577046, 28319064 View all (11 more)
Pancreatic Neoplasms	Associate	21329664, 24293293, 28059098, 30535494
Pancreatitis	Associate	25273089, 40138743
Papilloma	Associate	1321820
Papillomavirus Infections	Inhibit	14633593, 25035383
Papillomavirus Infections	Associate	26032781, 30189895
Parkinson Disease	Associate	25182869, 34130600
Paroxysmal nonkinesigenic dyskinesia	Associate	36717865
Penile Neoplasms	Associate	28751665
Peritoneal Neoplasms	Associate	34476575
Peritonitis	Associate	31568710
Personality Disorders	Associate	36573306
Phyllodes Tumor	Associate	26832993, 31647027, 32504368, 33727697
Pinealoma	Associate	25022261, 31768671, 33619588
Pituitary Diseases	Associate	15136974
Pituitary Neoplasms	Associate	12940460
Polycystic Ovary Syndrome	Inhibit	25603724
Polydactyly	Associate	11167295
Polyomavirus Infections	Associate	25291363
Polyps	Associate	14584071
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	30874617
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10733508, 15034294, 20435627, 23900870, 2404525, 30874617
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	15724842, 1993222, 27036041
Primary Myelofibrosis	Associate	18723266
Prodromal Symptoms	Associate	20594292, 30872465
Propping Zerres syndrome	Associate	33144218
Prostate cancer familial	Associate	7761404
Prostate Cancer Hereditary 7	Associate	26546618, 35331214, 37877742
Prostate Cancer Hereditary 7	Inhibit	32341031
Prostatic Hyperplasia	Associate	7526887
Prostatic Neoplasms	Associate	17218785, 20948989, 21099103, 26195723, 26444865, 26520443, 26546618, 28059768, 29681457, 29921690, 30339521, 30458854, 30833416, 31134918, 31352849 View all (22 more)
Prostatic Neoplasms	Inhibit	29202480, 9813067
Prostatic Neoplasms Castration Resistant	Inhibit	29921690, 34568716
Prostatic Neoplasms Castration Resistant	Associate	30928160, 31010837, 31061129, 31796516, 31874108, 32091413, 32268276, 34103179, 34462330, 35121110, 35304525, 35725469, 37967200, 38429210
Prostatitis	Associate	11943705, 2217208, 7526887
Protein S Deficiency	Associate	9420334
Psoriasis	Associate	29115643
Psychomotor Disorders	Associate	22909775
Pterygium	Associate	33299863
Pulmonary Arterial Hypertension	Associate	15136974
Pulmonary Disease Chronic Obstructive	Associate	31829519
Pyruvate Carboxylase Deficiency Disease	Associate	32460015
Radiation Injuries	Associate	36849151
Respiratory Tract Infections	Associate	26278805, 36818471
Retinal Dysplasia	Associate	16402033, 17461478
Retinal Neoplasms	Associate	20577596, 24911651, 31404748, 9400934
Retinal Neoplasms	Inhibit	32502182
Retinoblastoma	Associate	10366578, 10631148, 10792382, 11533045, 12016586, 12541220, 1350208, 1352883, 14726655, 15166261, 15632311, 16061792, 1648218, 17609271, 18073428 View all (164 more)
Retinoblastoma	Inhibit	11462030, 18782450, 21329664, 22232672, 22615382, 23826078, 24911651, 25252974, 26143641, 28575107, 29246572, 30312872, 30355646, 30996590, 32268247 View all (6 more)
Rhabdomyosarcoma	Associate	37593416
Rupture	Associate	36303246
Salivary Duct Calculi	Associate	14645349, 32929114
Sarcoma	Associate	15988141, 17094467, 29100075, 31568710, 36603130, 37536918, 7547254
Sarcoma	Inhibit	2217208
Sarcoma Ewing	Associate	11520274
Schizophrenia	Associate	15057823
Sebaceous Gland Neoplasms	Associate	34445161
Sezary Syndrome	Inhibit	16614728
Sezary Syndrome	Associate	26551667
Silver Russell Syndrome	Associate	25563730
Sinonasal undifferentiated carcinoma	Associate	36946265
Small Cell Lung Carcinoma	Associate	20615970, 2168563, 24978188, 25122428, 25758528, 25863124, 26008974, 26340530, 26647789, 26802149, 26960398, 27093186, 27105536, 27145273, 28228136 View all (29 more)
Small Cell Lung Carcinoma	Inhibit	28106103, 8052667, 9192669
Smooth Muscle Tumor	Associate	19808856
Soft Tissue Injuries	Associate	38488807
Soft Tissue Neoplasms	Associate	2765366, 29976943
Somatoform Disorders	Associate	36342106
Squamous Cell Carcinoma of Head and Neck	Associate	10389982, 15083191, 16467168, 16623759, 20226061, 23778529, 24982332, 26265441, 28984303, 29443735, 30189895, 30949979, 33172332, 33767253, 33830464
Squamous Cell Carcinoma of Head and Neck	Inhibit	27507850
Squamous Intraepithelial Lesions	Associate	12657136
Squamous Intraepithelial Lesions	Inhibit	16740689
Status Asthmaticus	Associate	16510457
Stickler syndrome type 3	Associate	33063942
Stomach Diseases	Associate	25631875, 34585958
Stomach Neoplasms	Associate	15906946, 17131485, 26867682, 27629734, 29791595, 35969010, 37843333, 7947078
Sveinsson Chorioretinal Atrophy	Associate	32931935, 34493366
Teratoma	Associate	25522918
Teratozoospermia	Associate	25762640
Testicular Germ Cell Tumor	Inhibit	17167184
Tetrasomy	Associate	15138476
Thymic epithelial tumor	Associate	26537237, 36307042
Thymoma	Associate	37749819
Thymus Neoplasms	Associate	37749819
Thyroid cancer follicular	Associate	21983636
Thyroid cancer medullary	Associate	27610696
Thyroid Carcinoma Anaplastic	Associate	28489587
Thyroid Neoplasms	Associate	15136974, 29271997
Tonsillar Neoplasms	Associate	19305381
Trichodysplasia Xeroderma	Associate	25291363
Triple Negative Breast Neoplasms	Associate	19372580, 21593597, 24096545, 24265703, 25961742, 29915391, 30704524, 31836816, 32075943, 32242058, 32377705, 34396843, 34525987, 36203222
Trisomy 13 Syndrome	Associate	2201915
Urethral Neoplasms	Associate	20890425, 22685613, 30293995, 38219954, 8950161
Urinary Bladder Diseases	Inhibit	29763719
Urinary Bladder Neoplasms	Associate	10376969, 12865920, 12875971, 14728297, 15226775, 15790699, 16402033, 17311305, 17384651, 17702869, 18008359, 19846973, 23897969, 24459064, 27270441 View all (13 more)
Uterine Cervical Dysplasia	Associate	11737469
Uterine Cervical Dysplasia	Inhibit	40362654
Uterine Cervical Neoplasms	Associate	10982822, 12657136, 15143339, 16004614, 1648218, 16740689, 17582001, 21835799, 2198278, 22692183, 23284001, 23874455, 30575267, 36807750, 36894874, 37699974, 9215125 View all (2 more)
Uterine Cervical Neoplasms	Inhibit	39481992, 40362654
Uterine Cervicitis	Associate	26032781
Uterine Diseases	Associate	34162378
Vascular Diseases	Associate	18981572
Viremia	Associate	22701041
Virus Diseases	Inhibit	12657136
Vulvar Diseases	Associate	11737469
Vulvar Neoplasms	Associate	11737469
Waldenstrom Macroglobulinemia	Associate	40349989
Weight Gain	Associate	23315497
Weight Loss	Associate	23315497
Wilms Tumor	Associate	22219649, 26925970

RB1 (RB transcriptional corepressor 1)