Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5923
Gene name	Ras protein specific guanine nucleotide releasing factor 1
Gene symbol	RASGRF1
Synonyms (NCBI Gene)	CDC25CDC25LGNRPGRF1GRF55H-GRF55PP13187ras-GRF1
Chromosome	15
Chromosome location	15q25.1
Summary	The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein. The stud

Show/Hide all (81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029141	hsa-miR-26b-5p	Microarray	19088304
MIRT437859	hsa-miR-483-3p	ImmunoblotImmunofluorescenceImmunoprecipitaionLuciferase reporter assayqRT-PCR	23429262
MIRT437859	hsa-miR-483-3p	ImmunoblotImmunofluorescenceImmunoprecipitaionLuciferase reporter assayqRT-PCR	23429262
MIRT1292283	hsa-miR-127-5p	CLIP-seq
MIRT1292284	hsa-miR-134	CLIP-seq
MIRT1292285	hsa-miR-3118	CLIP-seq
MIRT1292286	hsa-miR-3136-5p	CLIP-seq
MIRT1292287	hsa-miR-3164	CLIP-seq
MIRT1292288	hsa-miR-3921	CLIP-seq
MIRT1292289	hsa-miR-4251	CLIP-seq
MIRT1292290	hsa-miR-4329	CLIP-seq
MIRT1292291	hsa-miR-4439	CLIP-seq
MIRT1292292	hsa-miR-4513	CLIP-seq
MIRT1292293	hsa-miR-4653-5p	CLIP-seq
MIRT1292294	hsa-miR-4663	CLIP-seq
MIRT1292295	hsa-miR-4738-3p	CLIP-seq
MIRT1292296	hsa-miR-4765	CLIP-seq
MIRT1292297	hsa-miR-628-5p	CLIP-seq
MIRT1292298	hsa-miR-1265	CLIP-seq
MIRT1292284	hsa-miR-134	CLIP-seq
MIRT1292299	hsa-miR-2392	CLIP-seq
MIRT1292285	hsa-miR-3118	CLIP-seq
MIRT1292286	hsa-miR-3136-5p	CLIP-seq
MIRT1292300	hsa-miR-3158-3p	CLIP-seq
MIRT1292301	hsa-miR-3679-3p	CLIP-seq
MIRT1292302	hsa-miR-3973	CLIP-seq
MIRT1292303	hsa-miR-4258	CLIP-seq
MIRT1292304	hsa-miR-4424	CLIP-seq
MIRT1292291	hsa-miR-4439	CLIP-seq
MIRT1292305	hsa-miR-4446-3p	CLIP-seq
MIRT1292292	hsa-miR-4513	CLIP-seq
MIRT1292306	hsa-miR-4632	CLIP-seq
MIRT1292307	hsa-miR-4653-3p	CLIP-seq
MIRT1292294	hsa-miR-4663	CLIP-seq
MIRT1292295	hsa-miR-4738-3p	CLIP-seq
MIRT1292296	hsa-miR-4765	CLIP-seq
MIRT1292308	hsa-miR-490-3p	CLIP-seq
MIRT1292297	hsa-miR-628-5p	CLIP-seq
MIRT1292309	hsa-miR-649	CLIP-seq
MIRT1292284	hsa-miR-134	CLIP-seq
MIRT1292285	hsa-miR-3118	CLIP-seq
MIRT1292286	hsa-miR-3136-5p	CLIP-seq
MIRT1292291	hsa-miR-4439	CLIP-seq
MIRT1292292	hsa-miR-4513	CLIP-seq
MIRT1292294	hsa-miR-4663	CLIP-seq
MIRT1292295	hsa-miR-4738-3p	CLIP-seq
MIRT1292296	hsa-miR-4765	CLIP-seq
MIRT1292297	hsa-miR-628-5p	CLIP-seq
MIRT2086860	hsa-miR-1273d	CLIP-seq
MIRT2086861	hsa-miR-132	CLIP-seq
MIRT1292284	hsa-miR-134	CLIP-seq
MIRT2086862	hsa-miR-188-5p	CLIP-seq
MIRT2086863	hsa-miR-212	CLIP-seq
MIRT1292285	hsa-miR-3118	CLIP-seq
MIRT1292286	hsa-miR-3136-5p	CLIP-seq
MIRT2086864	hsa-miR-4287	CLIP-seq
MIRT2086865	hsa-miR-433	CLIP-seq
MIRT1292291	hsa-miR-4439	CLIP-seq
MIRT2086866	hsa-miR-4469	CLIP-seq
MIRT1292292	hsa-miR-4513	CLIP-seq
MIRT1292294	hsa-miR-4663	CLIP-seq
MIRT2086867	hsa-miR-4685-3p	CLIP-seq
MIRT2086868	hsa-miR-4712-3p	CLIP-seq
MIRT2086869	hsa-miR-4713-5p	CLIP-seq
MIRT2086870	hsa-miR-4724-5p	CLIP-seq
MIRT1292295	hsa-miR-4738-3p	CLIP-seq
MIRT1292296	hsa-miR-4765	CLIP-seq
MIRT2086871	hsa-miR-4777-5p	CLIP-seq
MIRT1292297	hsa-miR-628-5p	CLIP-seq
MIRT2086872	hsa-miR-642a	CLIP-seq
MIRT2086873	hsa-miR-942	CLIP-seq
MIRT2086874	hsa-miR-943	CLIP-seq
MIRT2311795	hsa-miR-4303	CLIP-seq
MIRT2311796	hsa-miR-1273g	CLIP-seq
MIRT1292283	hsa-miR-127-5p	CLIP-seq
MIRT1292287	hsa-miR-3164	CLIP-seq
MIRT1292288	hsa-miR-3921	CLIP-seq
MIRT1292289	hsa-miR-4251	CLIP-seq
MIRT2311795	hsa-miR-4303	CLIP-seq
MIRT1292290	hsa-miR-4329	CLIP-seq
MIRT1292293	hsa-miR-4653-5p	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IMP	27856453
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS	1379731, 7684828
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	NAS	10918068
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	TAS	7684828
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0007616	Process	Long-term memory	NAS	10918068
GO:0030426	Component	Growth cone	IEA
GO:0030426	Component	Growth cone	ISS
GO:0031175	Process	Neuron projection development	IEA
GO:0031175	Process	Neuron projection development	ISS
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IMP	27856453
GO:0035022	Process	Positive regulation of Rac protein signal transduction	IEA
GO:0035022	Process	Positive regulation of Rac protein signal transduction	ISS
GO:0035254	Function	Glutamate receptor binding	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043005	Component	Neuron projection	NAS	10918068
GO:0043409	Process	Negative regulation of MAPK cascade	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0044342	Process	Type B pancreatic cell proliferation	IEA
GO:0046578	Process	Regulation of Ras protein signal transduction	IEA
GO:0046578	Process	Regulation of Ras protein signal transduction	ISS
GO:0046579	Process	Positive regulation of Ras protein signal transduction	ISS
GO:0046579	Process	Positive regulation of Ras protein signal transduction	TAS	11877426
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048168	Process	Regulation of neuronal synaptic plasticity	IEA

MIM	HGNC	e!Ensembl
606600	9875	ENSG00000058335

Q13972

Protein name

Ras-specific guanine nucleotide-releasing factor 1 (Ras-GRF1) (Guanine nucleotide-releasing protein) (GNRP) (Ras-specific nucleotide exchange factor CDC25)

Protein function

Promotes the exchange of Ras-bound GDP by GTP.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	23 → 129	PH domain	Domain
PF00621	RhoGEF	244 → 424	RhoGEF domain	Domain
PF00169	PH	457 → 584	PH domain	Domain
PF00618	RasGEF_N	647 → 765	RasGEF N-terminal motif	Domain
PF00617	RasGEF	1041 → 1219	RasGEF domain	Family

Sequence

MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITS
LLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKRTREGTREAEMSRSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERL
TDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPISAIPARWLRSLELLFASGQNN
KLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSN
GYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMRE
ESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSAL
SAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRH
WVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLE
EITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIM
KTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSA
IFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFI
EEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESL
YESSLRIEPKLPT

Sequence length

1273

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Focal adhesion		RAF/MAP kinase cascade

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Benign	rs111385391	RCV005906416
Familial cancer of breast	Benign	rs111385391	RCV005906414
Hepatocellular carcinoma	Benign	rs111385391	RCV005906415
Ovarian serous cystadenocarcinoma	Benign	rs111385391	RCV005906417
Thyroid cancer, nonmedullary, 1	Benign	rs111385391	RCV005906418

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	34139453
Alzheimer Disease	Associate	31943943
Amyotrophic Lateral Sclerosis 2 Juvenile	Associate	30224357
Arthritis Rheumatoid	Associate	19678938, 20067598
Astrocytoma	Associate	26440052
Ataxia Telangiectasia	Associate	30679601
Breast Neoplasms	Associate	19124484, 27993161, 28356423
Carcinogenesis	Associate	35247929
Carcinoma Hepatocellular	Associate	33540684
Carcinoma Non Small Cell Lung	Associate	32312893
Carcinoma Pancreatic Ductal	Associate	35247929
Colitis Ulcerative	Associate	27575496
Colonic Neoplasms	Associate	25922072
Epstein Barr Virus Infections	Associate	20958979
Glioblastoma	Associate	23775076, 24518591
Immune System Diseases	Associate	32636302
Insulin Resistance	Associate	39180924
Intellectual Disability	Associate	20473311
Leukemia	Associate	15331592, 21151158
Lung Neoplasms	Associate	35512219
Melanoma	Associate	17389601
Myopia	Associate	24767175, 29044055, 29793445, 36864897
Neoplasm Metastasis	Associate	19124484
Neoplasms	Associate	19678938, 20974669, 24874604, 34139453, 35247929
Neoplasms	Stimulate	34487971
Neuroblastoma	Associate	18957052
Neurodegenerative Diseases	Associate	30679601
Noonan Syndrome	Associate	29074966
Refractive Errors	Associate	35885949
Sarcoma	Associate	35247929
Schizophrenia	Associate	28696354
Stomach Neoplasms	Associate	24072493

RASGRF1 (Ras protein specific guanine nucleotide releasing factor 1)