RASA2 (RAS p21 protein activator 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5922
Gene name Gene Name - the full gene name approved by the HGNC.
RAS p21 protein activator 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RASA2
Synonyms (NCBI Gene) Gene synonyms aliases
GAP1M
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q23
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is member of the GAP1 family of GTPase-activating proteins. The gene product stimulates the GTPase activity of normal RAS p21 but not its oncogenic counterpart. Acting as a suppressor of RAS function, the protein enhances
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(21)
miRTarBase ID miRNA Experiments Reference
MIRT018937 hsa-miR-335-5p Microarray 18185580
MIRT447367 hsa-miR-548l PAR-CLIP 22100165
MIRT447365 hsa-miR-3973 PAR-CLIP 22100165
MIRT447366 hsa-miR-4635 PAR-CLIP 22100165
MIRT447364 hsa-miR-4470 PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0005096 Function GTPase activator activity IBA
GO:0005096 Function GTPase activator activity IEA
GO:0005096 Function GTPase activator activity TAS 8812506
GO:0005515 Function Protein binding IPI 33961781
GO:0005543 Function Phospholipid binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601589 9872 ENSG00000155903
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q15283
Protein name Ras GTPase-activating protein 2 (GTPase-activating protein 1m) (GAP1m)
Protein function Inhibitory regulator of the Ras-cyclic AMP pathway. Binds inositol tetrakisphosphate (IP4).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00168 C2 38 → 140 C2 domain Domain
PF00168 C2 171 → 291 C2 domain Domain
PF00616 RasGAP 377 → 454 GTPase-activator protein for Ras-like GTPase Family
PF00616 RasGAP 444 → 550 GTPase-activator protein for Ras-like GTPase Family
PF00169 PH 605 → 706 PH domain Domain
PF00779 BTK 714 → 743 BTK motif Motif
Sequence 
MAAAAPAAAAASSEAPAASATAEPEAGDQDSREVRVLQSLRGKICEAKNLLPYLGPHKMR
DCFCTINLDQEEVYRTQVVEKSLSPFFSEEFYFEIPRTFQYLSFYVYDKNVLQRDLRIGK
VAIKKEDLCNHSGKETWFSLQPVDSNSEVQGKVHLELKLNELITENGTVCQQLVVHIKAC
HGLPLINGQSCDPYATVSLVGPSRNDQKKTKVKKKTSNPQFNEIFYFEVTRSSSYTRKSQ
FQVEEEDIEKLEIRIDLWNNGNLVQDVFLGEIKVPVNVLRTDSSHQAWYLLQPRDNGNKS
SKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPISASAAYILSEICRDKNDA
VLPLVRLLLHHDKLVPFATAVAELDLKDTQDANTIFRGNSLATRCLDEMMKIVGGHYLKV
TLKPILDEICDSSKSCEIDPIKLKEGDNVENNKENLRYYVDKLFNTIVKSSMSCPTVMCD
IFYSLRQMATQRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDAQTIRTLTL
ISKTIQTLGSWGSLSKSKSSFKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGT
SEPVHLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSRELTYHKQPGSKDAIYTIPVKNILA
VEKLEESSFNKKNMFQVIHTEKPLYVQANNCVEANEWIDVLCRVSRCNQNRLSFYHPSVY
LNGNWLCCQETGENTLGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSLLKLQKMEEAC
GTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGS
KENPIVGKAS
Sequence length 850
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
Viral carcinogenesis 		  Regulation of RAS by GAPs
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Noonan Syndrome Noonan syndrome N/A N/A GenCC
Show/Hide Text Mining Associations (13)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinogenesis Associate 27039262
Creutzfeldt Jakob Syndrome Associate 29216791
Insomnia Fatal Familial Associate 29216791
Lung Neoplasms Associate 40311306
Melanoma Associate 26502337
Myoclonus Associate 29216791
Neoplasms Inhibit 26502337
Noonan Syndrome Associate 25049390
Prion Diseases Associate 29216791
Prostatic Neoplasms Associate 26925973