RARRES2 (retinoic acid receptor responder 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 5919
Gene name Retinoic acid receptor responder 2
Gene symbol RARRES2
Synonyms (NCBI Gene)
HP10433TIG2
Chromosome 7
Chromosome location 7q36.1
Summary This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tis
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT017042 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (40)
GO ID Ontology Definition Evidence Reference
GO:0001523 Process Retinoid metabolic process IDA 9204961
GO:0001934 Process Positive regulation of protein phosphorylation IDA 17635925
GO:0003084 Process Positive regulation of systemic arterial blood pressure IEA
GO:0005102 Function Signaling receptor binding IBA
GO:0005102 Function Signaling receptor binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601973 9868 ENSG00000106538
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99969
Protein name Retinoic acid receptor responder protein 2 (Chemerin) (RAR-responsive protein TIG2) (Tazarotene-induced gene 2 protein)
Protein function Adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Also acts as a ligand for CMKLR2. Can also bind to C-C chemokine receptor-like 2 (CCRL2
PDB 7YKD , 8JJP , 8SG1 , 8XGM , 8ZJG , 9L3W , 9L3Y
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed at the highest levels in placenta, liver, and white adipose tissue (WAT), and to a lesser extent in many other tissues such as lung, brown adipose tissue, heart, ovary, kidney, skeletal muscle and pancreas. Within WAT, expres
Sequence 
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPF
PAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE
TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
Sequence length 163
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Platelet degranulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
PRE-ECLAMPSIA — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (83)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Anemia Associate 30866520
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Psoriatic Stimulate 19114666
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Psoriatic Inhibit 23144698
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Associate 21959042
★★★★★
★☆☆☆☆
Found in Text Mining only
Asthma Associate 26998837
★★★★★
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Associate 20145358, 21981776, 24779513, 29653511, 29853566, 30866520
★★★★★
★☆☆☆☆
Found in Text Mining only
Bone Diseases Metabolic Stimulate 36531488
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Stimulate 33753802
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 33066326
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Associate 28759013, 33828127, 37762031
★★★★★
★☆☆☆☆
Found in Text Mining only