Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5919
Gene name Gene Name - the full gene name approved by the HGNC.
Retinoic acid receptor responder 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RARRES2
Synonyms (NCBI Gene) Gene synonyms aliases
HP10433, TIG2
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q36.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tis
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017042 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001523 Process Retinoid metabolic process IDA 9204961
GO:0001934 Process Positive regulation of protein phosphorylation IDA 17635925
GO:0003084 Process Positive regulation of systemic arterial blood pressure IEA
GO:0005102 Function Signaling receptor binding IBA
GO:0005102 Function Signaling receptor binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601973 9868 ENSG00000106538
Protein
UniProt ID Q99969
Protein name Retinoic acid receptor responder protein 2 (Chemerin) (RAR-responsive protein TIG2) (Tazarotene-induced gene 2 protein)
Protein function Adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Also acts as a ligand for CMKLR2. Can also bind to C-C chemokine receptor-like 2 (CCRL2
PDB 7YKD , 8JJP , 8SG1 , 8XGM , 8ZJG , 9L3W , 9L3Y
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed at the highest levels in placenta, liver, and white adipose tissue (WAT), and to a lesser extent in many other tissues such as lung, brown adipose tissue, heart, ovary, kidney, skeletal muscle and pancreas. Within WAT, expres
Sequence
MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPF
PAGIFVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE
TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFAFSKALPRS
Sequence length 163
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Platelet degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Astrocytoma Pilocytic astrocytoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anemia Associate 30866520
Arthritis Psoriatic Stimulate 19114666
Arthritis Psoriatic Inhibit 23144698
Arthritis Rheumatoid Associate 21959042
Asthma Associate 26998837
Atherosclerosis Associate 20145358, 21981776, 24779513, 29653511, 29853566, 30866520
Bone Diseases Metabolic Stimulate 36531488
Breast Neoplasms Stimulate 33753802
Carcinoma Hepatocellular Associate 33066326
Carcinoma Renal Cell Associate 28759013, 33828127, 37762031