Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5918
Gene name Gene Name - the full gene name approved by the HGNC.	Retinoic acid receptor responder 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RARRES1
Synonyms (NCBI Gene) Gene synonyms aliases	LXNL, PERG-1, TIG1
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q25.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be dow

Show/Hide all(94)

miRTarBase ID	miRNA	Experiments
MIRT1291725	hsa-miR-186	CLIP-seq
MIRT1291726	hsa-miR-567	CLIP-seq
MIRT2608088	hsa-miR-125a-5p	CLIP-seq
MIRT2608089	hsa-miR-125b	CLIP-seq
MIRT2608090	hsa-miR-1284	CLIP-seq
MIRT2608091	hsa-miR-134	CLIP-seq
MIRT2608092	hsa-miR-138	CLIP-seq
MIRT2608093	hsa-miR-2054	CLIP-seq
MIRT2608094	hsa-miR-2115	CLIP-seq
MIRT2608095	hsa-miR-28-3p	CLIP-seq
MIRT2608096	hsa-miR-3118	CLIP-seq
MIRT2608097	hsa-miR-3144-3p	CLIP-seq
MIRT2608098	hsa-miR-3146	CLIP-seq
MIRT2608099	hsa-miR-3180-5p	CLIP-seq
MIRT2608100	hsa-miR-33a	CLIP-seq
MIRT2608101	hsa-miR-33b	CLIP-seq
MIRT2608102	hsa-miR-3613-3p	CLIP-seq
MIRT2608103	hsa-miR-370	CLIP-seq
MIRT2608104	hsa-miR-3914	CLIP-seq
MIRT2608105	hsa-miR-3915	CLIP-seq
MIRT2608106	hsa-miR-3928	CLIP-seq
MIRT2608107	hsa-miR-4276	CLIP-seq
MIRT2608108	hsa-miR-4299	CLIP-seq
MIRT2608109	hsa-miR-4302	CLIP-seq
MIRT2608110	hsa-miR-4303	CLIP-seq
MIRT2608111	hsa-miR-4319	CLIP-seq
MIRT2608112	hsa-miR-4446-5p	CLIP-seq
MIRT2608113	hsa-miR-4464	CLIP-seq
MIRT2608114	hsa-miR-4468	CLIP-seq
MIRT2608115	hsa-miR-452	CLIP-seq
MIRT2608116	hsa-miR-4676-3p	CLIP-seq
MIRT2608117	hsa-miR-4682	CLIP-seq
MIRT2608118	hsa-miR-4748	CLIP-seq
MIRT2608119	hsa-miR-4762-3p	CLIP-seq
MIRT2608120	hsa-miR-4796-5p	CLIP-seq
MIRT2608121	hsa-miR-491-3p	CLIP-seq
MIRT2608122	hsa-miR-520a-5p	CLIP-seq
MIRT2608123	hsa-miR-525-5p	CLIP-seq
MIRT2608124	hsa-miR-539	CLIP-seq
MIRT2608125	hsa-miR-544b	CLIP-seq
MIRT2608126	hsa-miR-548aa	CLIP-seq
MIRT2608127	hsa-miR-548ac	CLIP-seq
MIRT2608128	hsa-miR-548d-3p	CLIP-seq
MIRT2608129	hsa-miR-548z	CLIP-seq
MIRT2608130	hsa-miR-648	CLIP-seq
MIRT2608131	hsa-miR-875-5p	CLIP-seq
MIRT2608132	hsa-miR-943	CLIP-seq
MIRT2608133	hsa-miR-944	CLIP-seq
MIRT2608088	hsa-miR-125a-5p	CLIP-seq
MIRT2608089	hsa-miR-125b	CLIP-seq
MIRT2608090	hsa-miR-1284	CLIP-seq
MIRT2608091	hsa-miR-134	CLIP-seq
MIRT2608092	hsa-miR-138	CLIP-seq
MIRT2608093	hsa-miR-2054	CLIP-seq
MIRT2608094	hsa-miR-2115	CLIP-seq
MIRT2608095	hsa-miR-28-3p	CLIP-seq
MIRT2608096	hsa-miR-3118	CLIP-seq
MIRT2608097	hsa-miR-3144-3p	CLIP-seq
MIRT2608098	hsa-miR-3146	CLIP-seq
MIRT2608099	hsa-miR-3180-5p	CLIP-seq
MIRT2608100	hsa-miR-33a	CLIP-seq
MIRT2608101	hsa-miR-33b	CLIP-seq
MIRT2608102	hsa-miR-3613-3p	CLIP-seq
MIRT2608103	hsa-miR-370	CLIP-seq
MIRT2608104	hsa-miR-3914	CLIP-seq
MIRT2608105	hsa-miR-3915	CLIP-seq
MIRT2608106	hsa-miR-3928	CLIP-seq
MIRT2608107	hsa-miR-4276	CLIP-seq
MIRT2608108	hsa-miR-4299	CLIP-seq
MIRT2608109	hsa-miR-4302	CLIP-seq
MIRT2608110	hsa-miR-4303	CLIP-seq
MIRT2608111	hsa-miR-4319	CLIP-seq
MIRT2608112	hsa-miR-4446-5p	CLIP-seq
MIRT2608113	hsa-miR-4464	CLIP-seq
MIRT2608114	hsa-miR-4468	CLIP-seq
MIRT2608115	hsa-miR-452	CLIP-seq
MIRT2608116	hsa-miR-4676-3p	CLIP-seq
MIRT2608117	hsa-miR-4682	CLIP-seq
MIRT2608118	hsa-miR-4748	CLIP-seq
MIRT2608119	hsa-miR-4762-3p	CLIP-seq
MIRT2608120	hsa-miR-4796-5p	CLIP-seq
MIRT2608121	hsa-miR-491-3p	CLIP-seq
MIRT2608122	hsa-miR-520a-5p	CLIP-seq
MIRT2608123	hsa-miR-525-5p	CLIP-seq
MIRT2608124	hsa-miR-539	CLIP-seq
MIRT2608125	hsa-miR-544b	CLIP-seq
MIRT2608126	hsa-miR-548aa	CLIP-seq
MIRT2608127	hsa-miR-548ac	CLIP-seq
MIRT2608128	hsa-miR-548d-3p	CLIP-seq
MIRT2608129	hsa-miR-548z	CLIP-seq
MIRT2608130	hsa-miR-648	CLIP-seq
MIRT2608131	hsa-miR-875-5p	CLIP-seq
MIRT2608132	hsa-miR-943	CLIP-seq
MIRT2608133	hsa-miR-944	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
CTCF	Activation	22615834

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	31886233
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IBA	21873635
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010951	Process	Negative regulation of endopeptidase activity	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708

MIM	HGNC	e!Ensembl
605090	9867	ENSG00000118849

Protein

UniProt ID

P49788

Protein name

Retinoic acid receptor responder protein 1 (Phorbol ester-induced gene 1 protein) (PERG-1) (RAR-responsive protein TIG1) (Tazarotene-induced gene 1 protein)

Protein function

Inhibitor of the cytoplasmic carboxypeptidase AGBL2, may regulate the alpha-tubulin tyrosination cycle.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06907	Latexin	52 → 274	Latexin	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in urine (at protein level). {ECO:0000269|PubMed:36213313, ECO:0000269|PubMed:37453717}.

Sequence

MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQ
QAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGE
GRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDN
HGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLH
ELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF

Sequence length

294

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)	16134180

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Kidney Injury	Associate	37789254
Breast Neoplasms	Associate	22615834
Carcinogenesis	Associate	21303978
Carcinoma Ductal	Associate	34717732
Carcinoma Hepatocellular	Associate	24006221
Carcinoma Intraductal Noninfiltrating	Associate	34717732
Carcinoma Renal Cell	Associate	32307444, 36353618
Cholangiocarcinoma	Associate	17550320
Choriocarcinoma	Inhibit	29169400
Colonic Neoplasms	Inhibit	27989102
Colorectal Neoplasms	Inhibit	22126303
COVID 19	Associate	37789254
Endometrial Neoplasms	Associate	15886297
Esophageal Squamous Cell Carcinoma	Inhibit	16128742
Fatty Liver	Inhibit	30557378
Hyperinsulinism	Associate	30557378
Ichthyosis X Linked	Associate	33587010
Melanoma	Associate	21606880
Neoplasm Metastasis	Associate	17550320, 32307444
Neoplasms	Inhibit	15886297, 16952303, 21303978, 22126303, 22615834, 27989102, 28678839, 29169400, 29902837, 30557378, 31886233, 34769520, 36353618
Neoplasms	Associate	16128742, 20546602, 21606880, 24006221, 32307444
Neuroblastoma	Associate	20546602
Obesity	Associate	30557378
Ovarian Neoplasms	Inhibit	39972314
Pinguecula	Inhibit	34769520
Prostatic Neoplasms	Associate	21694441, 27708246, 30882175
Prostatic Neoplasms	Inhibit	28678839
Prostatitis	Inhibit	27989102
Pterygium	Inhibit	34769520
Stomach Neoplasms	Associate	16134180
Testicular Neoplasms	Associate	31886233
Uterine Cervical Neoplasms	Associate	29902837

RARRES1 (retinoic acid receptor responder 1)