Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5918
Gene name Gene Name - the full gene name approved by the HGNC.	Retinoic acid receptor responder 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RARRES1
Synonyms (NCBI Gene) Gene synonyms aliases	LXNL, PERG-1, TIG1
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q25.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be dow

Show/Hide all(94)

miRTarBase ID	miRNA	Experiments
MIRT1291725	hsa-miR-186	CLIP-seq
MIRT1291726	hsa-miR-567	CLIP-seq
MIRT2608088	hsa-miR-125a-5p	CLIP-seq
MIRT2608089	hsa-miR-125b	CLIP-seq
MIRT2608090	hsa-miR-1284	CLIP-seq
MIRT2608091	hsa-miR-134	CLIP-seq
MIRT2608092	hsa-miR-138	CLIP-seq
MIRT2608093	hsa-miR-2054	CLIP-seq
MIRT2608094	hsa-miR-2115	CLIP-seq
MIRT2608095	hsa-miR-28-3p	CLIP-seq
MIRT2608096	hsa-miR-3118	CLIP-seq
MIRT2608097	hsa-miR-3144-3p	CLIP-seq
MIRT2608098	hsa-miR-3146	CLIP-seq
MIRT2608099	hsa-miR-3180-5p	CLIP-seq
MIRT2608100	hsa-miR-33a	CLIP-seq
MIRT2608101	hsa-miR-33b	CLIP-seq
MIRT2608102	hsa-miR-3613-3p	CLIP-seq
MIRT2608103	hsa-miR-370	CLIP-seq
MIRT2608104	hsa-miR-3914	CLIP-seq
MIRT2608105	hsa-miR-3915	CLIP-seq
MIRT2608106	hsa-miR-3928	CLIP-seq
MIRT2608107	hsa-miR-4276	CLIP-seq
MIRT2608108	hsa-miR-4299	CLIP-seq
MIRT2608109	hsa-miR-4302	CLIP-seq
MIRT2608110	hsa-miR-4303	CLIP-seq
MIRT2608111	hsa-miR-4319	CLIP-seq
MIRT2608112	hsa-miR-4446-5p	CLIP-seq
MIRT2608113	hsa-miR-4464	CLIP-seq
MIRT2608114	hsa-miR-4468	CLIP-seq
MIRT2608115	hsa-miR-452	CLIP-seq
MIRT2608116	hsa-miR-4676-3p	CLIP-seq
MIRT2608117	hsa-miR-4682	CLIP-seq
MIRT2608118	hsa-miR-4748	CLIP-seq
MIRT2608119	hsa-miR-4762-3p	CLIP-seq
MIRT2608120	hsa-miR-4796-5p	CLIP-seq
MIRT2608121	hsa-miR-491-3p	CLIP-seq
MIRT2608122	hsa-miR-520a-5p	CLIP-seq
MIRT2608123	hsa-miR-525-5p	CLIP-seq
MIRT2608124	hsa-miR-539	CLIP-seq
MIRT2608125	hsa-miR-544b	CLIP-seq
MIRT2608126	hsa-miR-548aa	CLIP-seq
MIRT2608127	hsa-miR-548ac	CLIP-seq
MIRT2608128	hsa-miR-548d-3p	CLIP-seq
MIRT2608129	hsa-miR-548z	CLIP-seq
MIRT2608130	hsa-miR-648	CLIP-seq
MIRT2608131	hsa-miR-875-5p	CLIP-seq
MIRT2608132	hsa-miR-943	CLIP-seq
MIRT2608133	hsa-miR-944	CLIP-seq
MIRT2608088	hsa-miR-125a-5p	CLIP-seq
MIRT2608089	hsa-miR-125b	CLIP-seq
MIRT2608090	hsa-miR-1284	CLIP-seq
MIRT2608091	hsa-miR-134	CLIP-seq
MIRT2608092	hsa-miR-138	CLIP-seq
MIRT2608093	hsa-miR-2054	CLIP-seq
MIRT2608094	hsa-miR-2115	CLIP-seq
MIRT2608095	hsa-miR-28-3p	CLIP-seq
MIRT2608096	hsa-miR-3118	CLIP-seq
MIRT2608097	hsa-miR-3144-3p	CLIP-seq
MIRT2608098	hsa-miR-3146	CLIP-seq
MIRT2608099	hsa-miR-3180-5p	CLIP-seq
MIRT2608100	hsa-miR-33a	CLIP-seq
MIRT2608101	hsa-miR-33b	CLIP-seq
MIRT2608102	hsa-miR-3613-3p	CLIP-seq
MIRT2608103	hsa-miR-370	CLIP-seq
MIRT2608104	hsa-miR-3914	CLIP-seq
MIRT2608105	hsa-miR-3915	CLIP-seq
MIRT2608106	hsa-miR-3928	CLIP-seq
MIRT2608107	hsa-miR-4276	CLIP-seq
MIRT2608108	hsa-miR-4299	CLIP-seq
MIRT2608109	hsa-miR-4302	CLIP-seq
MIRT2608110	hsa-miR-4303	CLIP-seq
MIRT2608111	hsa-miR-4319	CLIP-seq
MIRT2608112	hsa-miR-4446-5p	CLIP-seq
MIRT2608113	hsa-miR-4464	CLIP-seq
MIRT2608114	hsa-miR-4468	CLIP-seq
MIRT2608115	hsa-miR-452	CLIP-seq
MIRT2608116	hsa-miR-4676-3p	CLIP-seq
MIRT2608117	hsa-miR-4682	CLIP-seq
MIRT2608118	hsa-miR-4748	CLIP-seq
MIRT2608119	hsa-miR-4762-3p	CLIP-seq
MIRT2608120	hsa-miR-4796-5p	CLIP-seq
MIRT2608121	hsa-miR-491-3p	CLIP-seq
MIRT2608122	hsa-miR-520a-5p	CLIP-seq
MIRT2608123	hsa-miR-525-5p	CLIP-seq
MIRT2608124	hsa-miR-539	CLIP-seq
MIRT2608125	hsa-miR-544b	CLIP-seq
MIRT2608126	hsa-miR-548aa	CLIP-seq
MIRT2608127	hsa-miR-548ac	CLIP-seq
MIRT2608128	hsa-miR-548d-3p	CLIP-seq
MIRT2608129	hsa-miR-548z	CLIP-seq
MIRT2608130	hsa-miR-648	CLIP-seq
MIRT2608131	hsa-miR-875-5p	CLIP-seq
MIRT2608132	hsa-miR-943	CLIP-seq
MIRT2608133	hsa-miR-944	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
CTCF	Activation	22615834

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21303978, 31886233
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9270552
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8601727
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708

MIM	HGNC	e!Ensembl
605090	9867	ENSG00000118849

Protein

UniProt ID

P49788

Protein name

Retinoic acid receptor responder protein 1 (Phorbol ester-induced gene 1 protein) (PERG-1) (RAR-responsive protein TIG1) (Tazarotene-induced gene 1 protein)

Protein function

Inhibitor of the cytoplasmic carboxypeptidase AGBL2, may regulate the alpha-tubulin tyrosination cycle.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06907	Latexin	52 → 274	Latexin	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in urine (at protein level). {ECO:0000269|PubMed:36213313, ECO:0000269|PubMed:37453717}.

Sequence

MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQ
QAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGE
GRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDN
HGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLH
ELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF

Sequence length

294

Interactions

View interactions

RARRES1 (retinoic acid receptor responder 1)