Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5916
Gene name Gene Name - the full gene name approved by the HGNC.
Retinoic acid receptor gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RARG
Synonyms (NCBI Gene) Gene synonyms aliases
NR1B3, RARC, RARgamma
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimer
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001222 hsa-miR-182-5p Luciferase reporter assay, Western blot 19782699
MIRT001222 hsa-miR-182-5p Luciferase reporter assay, Western blot 19782699
MIRT002564 hsa-miR-124-3p Microarray 15685193
MIRT017251 hsa-miR-335-5p Microarray 18185580
MIRT002564 hsa-miR-124-3p Microarray;Other 15685193
Transcription factors
Transcription factor Regulation Reference
JUN Repression 9377582
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA 21873635
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin IDA 21131358
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
180190 9866 ENSG00000172819
Protein
UniProt ID P13631
Protein name Retinoic acid receptor gamma (RAR-gamma) (Nuclear receptor subfamily 1 group B member 3)
Protein function Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR
PDB 1EXA , 1EXX , 1FCX , 1FCY , 1FCZ , 1FD0 , 2LBD , 3LBD , 4LBD , 5M24 , 6FX0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 88 157 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 226 403 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in aortic endothelial cells (at protein level). {ECO:0000269|PubMed:28167758}.
Sequence
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSK
EAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKME
IPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
Sequence length 454
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Nuclear Receptor transcription pathway
Signaling by Retinoic Acid
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
31374203
Unknown
Disease term Disease name Evidence References Source
Gout Gout GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 20543560
Arnold Chiari Malformation Associate 23437350
Barrett Esophagus Associate 20543560
Breast Neoplasms Associate 22084256
Carcinogenesis Associate 38245869
Carcinoma Hepatocellular Associate 28272990
Cardiotoxicity Associate 26237429, 32587261, 34861143, 35364012
Cholangiocarcinoma Associate 28272990
Colorectal Neoplasms Associate 28272990, 33472949
Colorectal Neoplasms Inhibit 38245869