Gene Gene information from NCBI Gene database.
Entrez ID 5916
Gene name Retinoic acid receptor gamma
Gene symbol RARG
Synonyms (NCBI Gene)
NR1B3RARCRARgamma
Chromosome 12
Chromosome location 12q13.13
Summary This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimer
miRNA miRNA information provided by mirtarbase database.
261
miRTarBase ID miRNA Experiments Reference
MIRT001222 hsa-miR-182-5p Luciferase reporter assayWestern blot 19782699
MIRT001222 hsa-miR-182-5p Luciferase reporter assayWestern blot 19782699
MIRT002564 hsa-miR-124-3p Microarray 15685193
MIRT017251 hsa-miR-335-5p Microarray 18185580
MIRT002564 hsa-miR-124-3p Microarray;Other 15685193
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
JUN Repression 9377582
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
89
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin IDA 21131358
GO:0000785 Component Chromatin ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
180190 9866 ENSG00000172819
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P13631
Protein name Retinoic acid receptor gamma (RAR-gamma) (Nuclear receptor subfamily 1 group B member 3)
Protein function Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR
PDB 1EXA , 1EXX , 1FCX , 1FCY , 1FCZ , 1FD0 , 2LBD , 3LBD , 4LBD , 5M24 , 6FX0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 88 157 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 226 403 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in aortic endothelial cells (at protein level). {ECO:0000269|PubMed:28167758}.
Sequence
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSK
EAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKME
IPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
Sequence length 454
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Nuclear Receptor transcription pathway
Signaling by Retinoic Acid
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Irido-corneo-trabecular dysgenesis Likely benign rs769476878 RCV000207406
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 20543560
Arnold Chiari Malformation Associate 23437350
Barrett Esophagus Associate 20543560
Breast Neoplasms Associate 22084256
Carcinogenesis Associate 38245869
Carcinoma Hepatocellular Associate 28272990
Cardiotoxicity Associate 26237429, 32587261, 34861143, 35364012
Cholangiocarcinoma Associate 28272990
Colorectal Neoplasms Associate 28272990, 33472949
Colorectal Neoplasms Inhibit 38245869