Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	5909
Gene name	RAP1 GTPase activating protein
Gene symbol	RAP1GAP
Synonyms (NCBI Gene)	RAP1GA1RAP1GAP1RAP1GAPIIRAPGAP
Chromosome	1
Chromosome location	1p36.12
Summary	This gene encodes a type of GTPase-activating-protein (GAP) that down-regulates the activity of the ras-related RAP1 protein. RAP1 acts as a molecular switch by cycling between an inactive GDP-bound form and an active GTP-bound form. The product of this g

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024590	hsa-miR-215-5p	Microarray	19074876
MIRT026546	hsa-miR-192-5p	Microarray	19074876
MIRT734048	hsa-miR-3121-3p	Luciferase reporter assayqRT-PCRWestern blotting	33178761
MIRT1290114	hsa-miR-1913	CLIP-seq
MIRT1290115	hsa-miR-2682	CLIP-seq
MIRT1290116	hsa-miR-3138	CLIP-seq
MIRT1290117	hsa-miR-3189-5p	CLIP-seq
MIRT1290118	hsa-miR-324-3p	CLIP-seq
MIRT1290119	hsa-miR-34a	CLIP-seq
MIRT1290120	hsa-miR-34c-5p	CLIP-seq
MIRT1290121	hsa-miR-3607-5p	CLIP-seq
MIRT1290122	hsa-miR-449a	CLIP-seq
MIRT1290123	hsa-miR-449b	CLIP-seq
MIRT1290124	hsa-miR-449c	CLIP-seq
MIRT1290125	hsa-miR-4520a-3p	CLIP-seq
MIRT1290126	hsa-miR-4690-3p	CLIP-seq
MIRT1290127	hsa-miR-4758-3p	CLIP-seq
MIRT1290128	hsa-miR-4761-3p	CLIP-seq
MIRT1290129	hsa-miR-940	CLIP-seq
MIRT1290114	hsa-miR-1913	CLIP-seq
MIRT1290115	hsa-miR-2682	CLIP-seq
MIRT1290116	hsa-miR-3138	CLIP-seq
MIRT1290118	hsa-miR-324-3p	CLIP-seq
MIRT1290119	hsa-miR-34a	CLIP-seq
MIRT1290120	hsa-miR-34c-5p	CLIP-seq
MIRT1290121	hsa-miR-3607-5p	CLIP-seq
MIRT1290122	hsa-miR-449a	CLIP-seq
MIRT1290123	hsa-miR-449b	CLIP-seq
MIRT1290124	hsa-miR-449c	CLIP-seq
MIRT1290125	hsa-miR-4520a-3p	CLIP-seq
MIRT1290126	hsa-miR-4690-3p	CLIP-seq
MIRT1290130	hsa-miR-4749-3p	CLIP-seq
MIRT1290128	hsa-miR-4761-3p	CLIP-seq
MIRT1290129	hsa-miR-940	CLIP-seq
MIRT1290131	hsa-miR-146b-3p	CLIP-seq
MIRT1290132	hsa-miR-2467-3p	CLIP-seq
MIRT1290133	hsa-miR-3158-5p	CLIP-seq
MIRT1290134	hsa-miR-3173-5p	CLIP-seq
MIRT1290135	hsa-miR-3678-3p	CLIP-seq
MIRT1290126	hsa-miR-4690-3p	CLIP-seq
MIRT1290136	hsa-miR-874	CLIP-seq
MIRT1556950	hsa-miR-1202	CLIP-seq
MIRT1556951	hsa-miR-125a-5p	CLIP-seq
MIRT1556952	hsa-miR-125b	CLIP-seq
MIRT1556953	hsa-miR-3194-5p	CLIP-seq
MIRT1556954	hsa-miR-3972	CLIP-seq
MIRT1556955	hsa-miR-4319	CLIP-seq
MIRT1556956	hsa-miR-4530	CLIP-seq
MIRT1556957	hsa-miR-4732-3p	CLIP-seq
MIRT1556958	hsa-miR-646	CLIP-seq
MIRT1556959	hsa-miR-670	CLIP-seq
MIRT1556956	hsa-miR-4530	CLIP-seq
MIRT1290126	hsa-miR-4690-3p	CLIP-seq
MIRT1556958	hsa-miR-646	CLIP-seq
MIRT1290114	hsa-miR-1913	CLIP-seq
MIRT1290118	hsa-miR-324-3p	CLIP-seq
MIRT2311392	hsa-miR-4257	CLIP-seq
MIRT2311393	hsa-miR-4328	CLIP-seq
MIRT1290126	hsa-miR-4690-3p	CLIP-seq
MIRT1290130	hsa-miR-4749-3p	CLIP-seq
MIRT2311394	hsa-miR-5096	CLIP-seq
MIRT2311395	hsa-miR-767-3p	CLIP-seq
MIRT2393471	hsa-miR-1321	CLIP-seq
MIRT1290114	hsa-miR-1913	CLIP-seq
MIRT2393472	hsa-miR-1915	CLIP-seq
MIRT2393473	hsa-miR-3134	CLIP-seq
MIRT1290118	hsa-miR-324-3p	CLIP-seq
MIRT2393474	hsa-miR-3612	CLIP-seq
MIRT2393475	hsa-miR-4270	CLIP-seq
MIRT2393476	hsa-miR-4441	CLIP-seq
MIRT2393477	hsa-miR-4443	CLIP-seq
MIRT2393478	hsa-miR-4534	CLIP-seq
MIRT1290126	hsa-miR-4690-3p	CLIP-seq
MIRT2393479	hsa-miR-4739	CLIP-seq
MIRT1290130	hsa-miR-4749-3p	CLIP-seq
MIRT2393480	hsa-miR-4756-5p	CLIP-seq
MIRT2393481	hsa-miR-4802-5p	CLIP-seq
MIRT2393482	hsa-miR-650	CLIP-seq
MIRT2457743	hsa-miR-1285	CLIP-seq
MIRT2457744	hsa-miR-3187-5p	CLIP-seq
MIRT2393474	hsa-miR-3612	CLIP-seq
MIRT2457745	hsa-miR-4459	CLIP-seq
MIRT2457746	hsa-miR-4695-5p	CLIP-seq
MIRT2457747	hsa-miR-612	CLIP-seq
MIRT2393482	hsa-miR-650	CLIP-seq
MIRT2457748	hsa-miR-665	CLIP-seq
MIRT2607726	hsa-miR-3649	CLIP-seq
MIRT2607727	hsa-miR-4283	CLIP-seq
MIRT2607728	hsa-miR-4489	CLIP-seq
MIRT2607729	hsa-miR-4685-5p	CLIP-seq
MIRT2607726	hsa-miR-3649	CLIP-seq
MIRT2607727	hsa-miR-4283	CLIP-seq
MIRT2607728	hsa-miR-4489	CLIP-seq
MIRT2607729	hsa-miR-4685-5p	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	TAS
GO:0003924	Function	GTPase activity	NAS	10476970
GO:0005096	Function	GTPase activator activity	EXP	16076873
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	15141215
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	1904317
GO:0005515	Function	Protein binding	IPI	18309292, 20877310, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005769	Component	Early endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA	10476970
GO:0005829	Component	Cytosol	TAS
GO:0006909	Process	Phagocytosis	IEA
GO:0007165	Process	Signal transduction	NAS	10476970
GO:0007165	Process	Signal transduction	TAS	1904317
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	10476970
GO:0016020	Component	Membrane	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030695	Function	GTPase regulator activity	IEA
GO:0031267	Function	Small GTPase binding	IPI	18309292
GO:0042803	Function	Protein homodimerization activity	IPI	18309292
GO:0043025	Component	Neuronal cell body	IEA
GO:0043087	Process	Regulation of GTPase activity	IDA	18309292
GO:0043547	Process	Positive regulation of GTPase activity	IDA	15141215
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:1903697	Process	Negative regulation of microvillus assembly	IMP	22797597
GO:1904442	Process	Negative regulation of thyroid gland epithelial cell proliferation	IEA
GO:1990792	Process	Cellular response to glial cell derived neurotrophic factor	IEA

MIM	HGNC	e!Ensembl
600278	9858	ENSG00000076864

P47736

Protein name

Rap1 GTPase-activating protein 1 (Rap1GAP) (Rap1GAP1)

Protein function

GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

PDB

1SRQ , 3BRW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02188	GoLoco	1 → 17	GoLoco motif	Motif
PF02145	Rap_GAP	210 → 391	Rap/ran-GAP	Family

Tissue specificity

TISSUE SPECIFICITY: Significant expression seen in the brain, kidney and pancreas. Abundant in the cerebral cortex and expressed at much lower levels in the spinal cord. Not detected in the lymphoid tissues. {ECO:0000269|PubMed:9346962}.

Sequence

MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTN
HEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDAALGHLVFSLKYDV
IGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRL
IVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFR
GGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDE
NTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPE
FQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMEN
GSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGSFAPNNPDLAKAAGISLIV
PGKSPTRKKSGPFGSRRSSAIGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQ
SSPEMPTTKNRAETAAQRAEALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGT
PHKRDSFIYSTWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASEQHMPQ
LGC

Sequence length

663

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway		Rap1 signalling RET signaling

RAP1GAP (RAP1 GTPase activating protein)