Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5909
Gene name Gene Name - the full gene name approved by the HGNC.	RAP1 GTPase activating protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RAP1GAP
Synonyms (NCBI Gene) Gene synonyms aliases	RAP1GA1, RAP1GAP1, RAP1GAPII, RAPGAP
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a type of GTPase-activating-protein (GAP) that down-regulates the activity of the ras-related RAP1 protein. RAP1 acts as a molecular switch by cycling between an inactive GDP-bound form and an active GTP-bound form. The product of this g

Show/Hide all(94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024590	hsa-miR-215-5p	Microarray	19074876
MIRT026546	hsa-miR-192-5p	Microarray	19074876
MIRT734048	hsa-miR-3121-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33178761
MIRT1290114	hsa-miR-1913	CLIP-seq
MIRT1290115	hsa-miR-2682	CLIP-seq
MIRT1290116	hsa-miR-3138	CLIP-seq
MIRT1290117	hsa-miR-3189-5p	CLIP-seq
MIRT1290118	hsa-miR-324-3p	CLIP-seq
MIRT1290119	hsa-miR-34a	CLIP-seq
MIRT1290120	hsa-miR-34c-5p	CLIP-seq
MIRT1290121	hsa-miR-3607-5p	CLIP-seq
MIRT1290122	hsa-miR-449a	CLIP-seq
MIRT1290123	hsa-miR-449b	CLIP-seq
MIRT1290124	hsa-miR-449c	CLIP-seq
MIRT1290125	hsa-miR-4520a-3p	CLIP-seq
MIRT1290126	hsa-miR-4690-3p	CLIP-seq
MIRT1290127	hsa-miR-4758-3p	CLIP-seq
MIRT1290128	hsa-miR-4761-3p	CLIP-seq
MIRT1290129	hsa-miR-940	CLIP-seq
MIRT1290114	hsa-miR-1913	CLIP-seq
MIRT1290115	hsa-miR-2682	CLIP-seq
MIRT1290116	hsa-miR-3138	CLIP-seq
MIRT1290118	hsa-miR-324-3p	CLIP-seq
MIRT1290119	hsa-miR-34a	CLIP-seq
MIRT1290120	hsa-miR-34c-5p	CLIP-seq
MIRT1290121	hsa-miR-3607-5p	CLIP-seq
MIRT1290122	hsa-miR-449a	CLIP-seq
MIRT1290123	hsa-miR-449b	CLIP-seq
MIRT1290124	hsa-miR-449c	CLIP-seq
MIRT1290125	hsa-miR-4520a-3p	CLIP-seq
MIRT1290126	hsa-miR-4690-3p	CLIP-seq
MIRT1290130	hsa-miR-4749-3p	CLIP-seq
MIRT1290128	hsa-miR-4761-3p	CLIP-seq
MIRT1290129	hsa-miR-940	CLIP-seq
MIRT1290131	hsa-miR-146b-3p	CLIP-seq
MIRT1290132	hsa-miR-2467-3p	CLIP-seq
MIRT1290133	hsa-miR-3158-5p	CLIP-seq
MIRT1290134	hsa-miR-3173-5p	CLIP-seq
MIRT1290135	hsa-miR-3678-3p	CLIP-seq
MIRT1290126	hsa-miR-4690-3p	CLIP-seq
MIRT1290136	hsa-miR-874	CLIP-seq
MIRT1556950	hsa-miR-1202	CLIP-seq
MIRT1556951	hsa-miR-125a-5p	CLIP-seq
MIRT1556952	hsa-miR-125b	CLIP-seq
MIRT1556953	hsa-miR-3194-5p	CLIP-seq
MIRT1556954	hsa-miR-3972	CLIP-seq
MIRT1556955	hsa-miR-4319	CLIP-seq
MIRT1556956	hsa-miR-4530	CLIP-seq
MIRT1556957	hsa-miR-4732-3p	CLIP-seq
MIRT1556958	hsa-miR-646	CLIP-seq
MIRT1556959	hsa-miR-670	CLIP-seq
MIRT1556956	hsa-miR-4530	CLIP-seq
MIRT1290126	hsa-miR-4690-3p	CLIP-seq
MIRT1556958	hsa-miR-646	CLIP-seq
MIRT1290114	hsa-miR-1913	CLIP-seq
MIRT1290118	hsa-miR-324-3p	CLIP-seq
MIRT2311392	hsa-miR-4257	CLIP-seq
MIRT2311393	hsa-miR-4328	CLIP-seq
MIRT1290126	hsa-miR-4690-3p	CLIP-seq
MIRT1290130	hsa-miR-4749-3p	CLIP-seq
MIRT2311394	hsa-miR-5096	CLIP-seq
MIRT2311395	hsa-miR-767-3p	CLIP-seq
MIRT2393471	hsa-miR-1321	CLIP-seq
MIRT1290114	hsa-miR-1913	CLIP-seq
MIRT2393472	hsa-miR-1915	CLIP-seq
MIRT2393473	hsa-miR-3134	CLIP-seq
MIRT1290118	hsa-miR-324-3p	CLIP-seq
MIRT2393474	hsa-miR-3612	CLIP-seq
MIRT2393475	hsa-miR-4270	CLIP-seq
MIRT2393476	hsa-miR-4441	CLIP-seq
MIRT2393477	hsa-miR-4443	CLIP-seq
MIRT2393478	hsa-miR-4534	CLIP-seq
MIRT1290126	hsa-miR-4690-3p	CLIP-seq
MIRT2393479	hsa-miR-4739	CLIP-seq
MIRT1290130	hsa-miR-4749-3p	CLIP-seq
MIRT2393480	hsa-miR-4756-5p	CLIP-seq
MIRT2393481	hsa-miR-4802-5p	CLIP-seq
MIRT2393482	hsa-miR-650	CLIP-seq
MIRT2457743	hsa-miR-1285	CLIP-seq
MIRT2457744	hsa-miR-3187-5p	CLIP-seq
MIRT2393474	hsa-miR-3612	CLIP-seq
MIRT2457745	hsa-miR-4459	CLIP-seq
MIRT2457746	hsa-miR-4695-5p	CLIP-seq
MIRT2457747	hsa-miR-612	CLIP-seq
MIRT2393482	hsa-miR-650	CLIP-seq
MIRT2457748	hsa-miR-665	CLIP-seq
MIRT2607726	hsa-miR-3649	CLIP-seq
MIRT2607727	hsa-miR-4283	CLIP-seq
MIRT2607728	hsa-miR-4489	CLIP-seq
MIRT2607729	hsa-miR-4685-5p	CLIP-seq
MIRT2607726	hsa-miR-3649	CLIP-seq
MIRT2607727	hsa-miR-4283	CLIP-seq
MIRT2607728	hsa-miR-4489	CLIP-seq
MIRT2607729	hsa-miR-4685-5p	CLIP-seq

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	TAS
GO:0003924	Function	GTPase activity	NAS	10476970
GO:0005096	Function	GTPase activator activity	EXP	16076873
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	15141215
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	1904317
GO:0005515	Function	Protein binding	IPI	18309292, 20877310, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005769	Component	Early endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA	10476970
GO:0005829	Component	Cytosol	TAS
GO:0006909	Process	Phagocytosis	IEA
GO:0007165	Process	Signal transduction	NAS	10476970
GO:0007165	Process	Signal transduction	TAS	1904317
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	10476970
GO:0016020	Component	Membrane	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030695	Function	GTPase regulator activity	IEA
GO:0031267	Function	Small GTPase binding	IPI	18309292
GO:0042803	Function	Protein homodimerization activity	IPI	18309292
GO:0043025	Component	Neuronal cell body	IEA
GO:0043087	Process	Regulation of GTPase activity	IDA	18309292
GO:0043547	Process	Positive regulation of GTPase activity	IDA	15141215
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:1903697	Process	Negative regulation of microvillus assembly	IMP	22797597
GO:1904442	Process	Negative regulation of thyroid gland epithelial cell proliferation	IEA
GO:1990792	Process	Cellular response to glial cell derived neurotrophic factor	IEA

MIM	HGNC	e!Ensembl
600278	9858	ENSG00000076864

Protein

UniProt ID

P47736

Protein name

Rap1 GTPase-activating protein 1 (Rap1GAP) (Rap1GAP1)

Protein function

GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

PDB

1SRQ , 3BRW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02188	GoLoco	1 → 17	GoLoco motif	Motif
PF02145	Rap_GAP	210 → 391	Rap/ran-GAP	Family

Tissue specificity

TISSUE SPECIFICITY: Significant expression seen in the brain, kidney and pancreas. Abundant in the cerebral cortex and expressed at much lower levels in the spinal cord. Not detected in the lymphoid tissues. {ECO:0000269|PubMed:9346962}.

Sequence

MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTN
HEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDAALGHLVFSLKYDV
IGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRL
IVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVKLQDFKGFR
GGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQQLQRKRHIGNDIVAVVFQDE
NTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLPDPAVFRKGPE
FQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMEN
GSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGSFAPNNPDLAKAAGISLIV
PGKSPTRKKSGPFGSRRSSAIGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQ
SSPEMPTTKNRAETAAQRAEALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGT
PHKRDSFIYSTWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASEQHMPQ
LGC

Sequence length

663

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway		Rap1 signalling RET signaling

RAP1GAP (RAP1 GTPase activating protein)