CARD18 (caspase recruitment domain family member 18)

Gene

• Entrez ID: 59082
• Gene name: Caspase recruitment domain family member 18
• Gene symbol: CARD18
• Synonyms (NCBI Gene): ICEBERG, UNQ5804, pseudo-ICE
• Chromosome: 11
• Chromosome location: 11q22.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT862784	hsa-miR-1321	CLIP-seq
MIRT862785	hsa-miR-3126-5p	CLIP-seq
MIRT862786	hsa-miR-3153	CLIP-seq
MIRT862787	hsa-miR-3202	CLIP-seq
MIRT862788	hsa-miR-4476	CLIP-seq
MIRT862789	hsa-miR-4728-5p	CLIP-seq
MIRT862790	hsa-miR-4739	CLIP-seq
MIRT862791	hsa-miR-4756-5p	CLIP-seq
MIRT862786	hsa-miR-3153	CLIP-seq
MIRT1955900	hsa-miR-3185	CLIP-seq
MIRT1955901	hsa-miR-3192	CLIP-seq
MIRT862787	hsa-miR-3202	CLIP-seq
MIRT1955902	hsa-miR-326	CLIP-seq
MIRT1955903	hsa-miR-330-5p	CLIP-seq
MIRT1955904	hsa-miR-4314	CLIP-seq
MIRT862788	hsa-miR-4476	CLIP-seq
MIRT1955905	hsa-miR-4646-5p	CLIP-seq
MIRT1955906	hsa-miR-4747-5p	CLIP-seq
MIRT1955907	hsa-miR-7	CLIP-seq
MIRT1955900	hsa-miR-3185	CLIP-seq
MIRT1955907	hsa-miR-7	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	11536016, 15383541, 27043298
GO:0006508	Process	Proteolysis	IEA
GO:0006954	Process	Inflammatory response	NAS	11051551
GO:0019899	Function	Enzyme binding	IEA
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0032091	Process	Negative regulation of protein binding	IDA	11536016
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IDA	11536016, 11821383
GO:0032991	Component	Protein-containing complex	IDA	11536016, 11821383, 15383541
GO:0032991	Component	Protein-containing complex	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0050700	Function	CARD domain binding	IPI	11821383
GO:0089720	Function	Caspase binding	IPI	11536016

Other IDs

• MIM: 605354
• HGNC: 28861
• e!Ensembl: ENSG00000255501

Protein

• UniProt ID: P57730
• Protein name: Caspase recruitment domain-containing protein 18 (Caspase-1 inhibitor Iceberg)
• Protein function: Inhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B.
• PDB: 1DGN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00619	CARD	3 → 90	Caspase recruitment domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Primarily expressed in the heart and placenta. {ECO:0000269|PubMed:11051551}.
• Sequence:

  MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDL
  VTGKGPKSCCKFIKHLCEEDPQLASKMGLH

• Sequence length: 90

Pathways

KEGG:

NOD-like receptor signaling pathway