CARD18 (caspase recruitment domain family member 18)

Gene

• Entrez ID: 59082
• Gene name: Caspase recruitment domain family member 18
• Gene symbol: CARD18
• Synonyms (NCBI Gene): ICEBERG, UNQ5804, pseudo-ICE
• Chromosome: 11
• Chromosome location: 11q22.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT862784	hsa-miR-1321	CLIP-seq
MIRT862785	hsa-miR-3126-5p	CLIP-seq
MIRT862786	hsa-miR-3153	CLIP-seq
MIRT862787	hsa-miR-3202	CLIP-seq
MIRT862788	hsa-miR-4476	CLIP-seq
MIRT862789	hsa-miR-4728-5p	CLIP-seq
MIRT862790	hsa-miR-4739	CLIP-seq
MIRT862791	hsa-miR-4756-5p	CLIP-seq
MIRT862786	hsa-miR-3153	CLIP-seq
MIRT1955900	hsa-miR-3185	CLIP-seq
MIRT1955901	hsa-miR-3192	CLIP-seq
MIRT862787	hsa-miR-3202	CLIP-seq
MIRT1955902	hsa-miR-326	CLIP-seq
MIRT1955903	hsa-miR-330-5p	CLIP-seq
MIRT1955904	hsa-miR-4314	CLIP-seq
MIRT862788	hsa-miR-4476	CLIP-seq
MIRT1955905	hsa-miR-4646-5p	CLIP-seq
MIRT1955906	hsa-miR-4747-5p	CLIP-seq
MIRT1955907	hsa-miR-7	CLIP-seq
MIRT1955900	hsa-miR-3185	CLIP-seq
MIRT1955907	hsa-miR-7	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	11536016, 15383541, 27043298
GO:0006954	Process	Inflammatory response	NAS	11051551
GO:0032091	Process	Negative regulation of protein binding	IDA	11536016
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IDA	11536016, 11821383
GO:0032991	Component	Protein-containing complex	IBA	21873635
GO:0032991	Component	Protein-containing complex	IDA	11536016, 11821383, 15383541
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0050700	Function	CARD domain binding	IPI	11821383
GO:0089720	Function	Caspase binding	IBA	21873635
GO:0089720	Function	Caspase binding	IPI	11536016
GO:0097340	Process	Inhibition of cysteine-type endopeptidase activity	IDA	11821383

Other IDs

• MIM: 605354
• HGNC: 28861
• e!Ensembl: ENSG00000255501

Protein

• UniProt ID: P57730
• Protein name: Caspase recruitment domain-containing protein 18 (Caspase-1 inhibitor Iceberg)
• Protein function: Inhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B.
• PDB: 1DGN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00619	CARD	3 → 90	Caspase recruitment domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Primarily expressed in the heart and placenta. {ECO:0000269|PubMed:11051551}.
• Sequence:

  MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDL
  VTGKGPKSCCKFIKHLCEEDPQLASKMGLH

• Sequence length: 90

Pathways

KEGG:

NOD-like receptor signaling pathway

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Carcinoma	Squamous cell carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	22514692
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193	22514692

Unknown
Disease term	Disease name	Evidence	References	Source
Diabetic Retinopathy	Diabetic Retinopathy			GWAS
Alzheimer disease	Alzheimer disease			GWAS
Restless Legs Syndrome	Restless Legs Syndrome			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Esophageal Squamous Cell Carcinoma	Associate	35789548
Hypoxia	Associate	35789548