RANGAP1 (Ran GTPase activating protein 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5905
Gene name Gene Name - the full gene name approved by the HGNC.
Ran GTPase activating protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RANGAP1
Synonyms (NCBI Gene) Gene synonyms aliases
Fug1, RANGAP, SD
Disease Acronyms (UniProt) Disease acronyms from UniProt database
SD
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. The encoded protein interacts with Ras-related nuclear protein 1 (RAN) and regulates guanosine triphosphate (GTP)-binding an
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(912)
miRTarBase ID miRNA Experiments Reference
MIRT031630 hsa-miR-16-5p Proteomics 18668040
MIRT049887 hsa-miR-31-5p CLASH 23622248
MIRT049661 hsa-miR-92a-3p CLASH 23622248
MIRT043425 hsa-miR-331-3p CLASH 23622248
MIRT036035 hsa-miR-1301-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(30)
GO ID Ontology Definition Evidence Reference
GO:0000776 Component Kinetochore IDA 17363900
GO:0000777 Component Condensed chromosome kinetochore IEA
GO:0003723 Function RNA binding IDA 26308891
GO:0005096 Function GTPase activator activity IDA 16428860
GO:0005515 Function Protein binding IPI 14729961, 16204249, 16732283, 17000644, 17036045, 17099698, 17099700, 18093978, 19549727, 20414307, 21988832, 22194619, 23395904, 25959826, 26496610, 28514442, 32814053
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602362 9854 ENSG00000100401
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P46060
Protein name Ran GTPase-activating protein 1 (RanGAP1)
Protein function GTPase activator for RAN (PubMed:16428860, PubMed:8146159, PubMed:8896452). Converts cytoplasmic GTP-bound RAN to GDP-bound RAN, which is essential for RAN-mediated nuclear import and export (PubMed:27160050, PubMed:8896452). Mediates dissociati
PDB 1Z5S , 2GRN , 2GRO , 2GRP , 2GRQ , 2GRR , 2IO2 , 2IO3 , 2IY0 , 3UIN , 3UIO , 3UIP , 5D2M , 9B62
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13516 LRR_6 112 → 132 Leucine Rich repeat Repeat
PF13516 LRR_6 321 → 341 Leucine Rich repeat Repeat
PF07834 RanGAP1_C 371 → 585 RanGAP1 C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain, thymus and testis. {ECO:0000269|PubMed:8973340}.
Sequence 
MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNT
VGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLS
DNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPL
ALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAFAVNPLLRV
INLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNL
SFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDD
EDEEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQRGQGEKSATPSRKILDPNTG
EPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVF
KDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLM
ALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Sequence length 587
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Nucleocytoplasmic transport   Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Rev-mediated nuclear export of HIV RNA
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
SUMO E3 ligases SUMOylate target proteins
SUMOylation of DNA replication proteins
RHO GTPases Activate Formins
Mitotic Prometaphase
Postmitotic nuclear pore complex (NPC) reformation
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Diffuse lymphoma Diffuse Large B-Cell Lymphoma rs121912651, rs121913289, rs121913293, rs878854402, rs869025340, rs1349928568, rs1569115687, rs121913291 27150054
Show/Hide Unknown Diseases (4)
Unknown
Disease term Disease name Evidence References Source
Schizophrenia Schizophrenia GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Uterine Fibroids Uterine Fibroids GWAS
Alzheimer disease Alzheimer disease GWAS
Show/Hide Text Mining Associations (11)
Associations from Text Mining
Disease Name Relationship Type References
Aneurysm Ruptured Associate 34611229
Arthritis Rheumatoid Inhibit 22183962
Burkitt Lymphoma Stimulate 24223200
Hodgkin Disease Associate 24223200
Keloid Associate 36916534
Leukemia Myelogenous Chronic BCR ABL Positive Associate 27228340
Lymphoma B Cell Associate 24223200
Lymphoma Large B Cell Diffuse Associate 24223200
Lymphoma Mantle Cell Associate 24223200
Neoplasm Metastasis Associate 22832492