Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5902
Gene name Gene Name - the full gene name approved by the HGNC.	RAN binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RANBP1
Synonyms (NCBI Gene) Gene synonyms aliases	HTF9A
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q11.21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that forms a complex with Ras-related nuclear protein (Ran) and metabolizes guanoside triphosphate (GTP). This complex participates in the regulation of the cell cycle by controlling transport of proteins and nucleic acids into

Show/Hide all(46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050368	hsa-miR-24-3p	CLASH	23622248
MIRT573574	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT573572	hsa-miR-3662	PAR-CLIP	20371350
MIRT573573	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT573570	hsa-miR-3646	PAR-CLIP	20371350
MIRT573571	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT573569	hsa-miR-5584-3p	PAR-CLIP	20371350
MIRT573568	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT573567	hsa-miR-584-3p	PAR-CLIP	20371350
MIRT573566	hsa-miR-4277	PAR-CLIP	20371350
MIRT573565	hsa-miR-4780	PAR-CLIP	20371350
MIRT573564	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT573563	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT573562	hsa-miR-623	PAR-CLIP	20371350
MIRT573561	hsa-miR-6083	PAR-CLIP	20371350
MIRT573574	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT573572	hsa-miR-3662	PAR-CLIP	20371350
MIRT573573	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT573570	hsa-miR-3646	PAR-CLIP	20371350
MIRT573571	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT573569	hsa-miR-5584-3p	PAR-CLIP	20371350
MIRT573568	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT573567	hsa-miR-584-3p	PAR-CLIP	20371350
MIRT573566	hsa-miR-4277	PAR-CLIP	20371350
MIRT573565	hsa-miR-4780	PAR-CLIP	20371350
MIRT573564	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT573563	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT573562	hsa-miR-623	PAR-CLIP	20371350
MIRT573561	hsa-miR-6083	PAR-CLIP	20371350
MIRT1289465	hsa-miR-1207-5p	CLIP-seq
MIRT1289466	hsa-miR-186	CLIP-seq
MIRT1289467	hsa-miR-3184	CLIP-seq
MIRT1289468	hsa-miR-410	CLIP-seq
MIRT1289469	hsa-miR-423-5p	CLIP-seq
MIRT1289470	hsa-miR-4688	CLIP-seq
MIRT1289471	hsa-miR-4763-3p	CLIP-seq
MIRT1289472	hsa-miR-486-3p	CLIP-seq
MIRT1289473	hsa-miR-495	CLIP-seq
MIRT1289474	hsa-miR-548ac	CLIP-seq
MIRT1289475	hsa-miR-548ae	CLIP-seq
MIRT1289476	hsa-miR-548aj	CLIP-seq
MIRT1289477	hsa-miR-548am	CLIP-seq
MIRT1289478	hsa-miR-548d-3p	CLIP-seq
MIRT1289479	hsa-miR-548x	CLIP-seq
MIRT1289480	hsa-miR-548z	CLIP-seq
MIRT1289481	hsa-miR-583	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005092	Function	GDP-dissociation inhibitor activity	IMP	7616957
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	7616957, 16428860
GO:0005634	Component	Nucleus	TAS	16130169
GO:0005635	Component	Nuclear envelope	TAS
GO:0005643	Component	Nuclear pore	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	25743254
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005813	Component	Centrosome	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006913	Process	Nucleocytoplasmic transport	IEA
GO:0007165	Process	Signal transduction	TAS	7882974, 16130169
GO:0031267	Function	Small GTPase binding	TAS	7882974
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046604	Process	Positive regulation of mitotic centrosome separation	IBA

MIM	HGNC	e!Ensembl
601180	9847	ENSG00000099901

Protein

UniProt ID

P43487

Protein name

Ran-specific GTPase-activating protein (Ran-binding protein 1) (RanBP1)

Protein function

Plays a role in RAN-dependent nucleocytoplasmic transport. Alleviates the TNPO1-dependent inhibition of RAN GTPase activity and mediates the dissociation of RAN from proteins involved in transport into the nucleus (By similarity). Induces a conf

PDB

1K5D , 1K5G

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00638	Ran_BP1	37 → 161	RanBP1 domain	Domain

Sequence

MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
ENDLPEWKERGTGDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKV
AEKLEALSVKEETKEDAEEKQ

Sequence length

201

Interactions

View interactions

	KEGG		Reactome
	Human T-cell leukemia virus 1 infection Viral carcinogenesis		Rev-mediated nuclear export of HIV RNA

RANBP1 (RAN binding protein 1)