Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5902
Gene name Gene Name - the full gene name approved by the HGNC.	RAN binding protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RANBP1
Synonyms (NCBI Gene) Gene synonyms aliases	HTF9A
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q11.21
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that forms a complex with Ras-related nuclear protein (Ran) and metabolizes guanoside triphosphate (GTP). This complex participates in the regulation of the cell cycle by controlling transport of proteins and nucleic acids into

Show/Hide all(46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050368	hsa-miR-24-3p	CLASH	23622248
MIRT573574	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT573572	hsa-miR-3662	PAR-CLIP	20371350
MIRT573573	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT573570	hsa-miR-3646	PAR-CLIP	20371350
MIRT573571	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT573569	hsa-miR-5584-3p	PAR-CLIP	20371350
MIRT573568	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT573567	hsa-miR-584-3p	PAR-CLIP	20371350
MIRT573566	hsa-miR-4277	PAR-CLIP	20371350
MIRT573565	hsa-miR-4780	PAR-CLIP	20371350
MIRT573564	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT573563	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT573562	hsa-miR-623	PAR-CLIP	20371350
MIRT573561	hsa-miR-6083	PAR-CLIP	20371350
MIRT573574	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT573572	hsa-miR-3662	PAR-CLIP	20371350
MIRT573573	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT573570	hsa-miR-3646	PAR-CLIP	20371350
MIRT573571	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT573569	hsa-miR-5584-3p	PAR-CLIP	20371350
MIRT573568	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT573567	hsa-miR-584-3p	PAR-CLIP	20371350
MIRT573566	hsa-miR-4277	PAR-CLIP	20371350
MIRT573565	hsa-miR-4780	PAR-CLIP	20371350
MIRT573564	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT573563	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT573562	hsa-miR-623	PAR-CLIP	20371350
MIRT573561	hsa-miR-6083	PAR-CLIP	20371350
MIRT1289465	hsa-miR-1207-5p	CLIP-seq
MIRT1289466	hsa-miR-186	CLIP-seq
MIRT1289467	hsa-miR-3184	CLIP-seq
MIRT1289468	hsa-miR-410	CLIP-seq
MIRT1289469	hsa-miR-423-5p	CLIP-seq
MIRT1289470	hsa-miR-4688	CLIP-seq
MIRT1289471	hsa-miR-4763-3p	CLIP-seq
MIRT1289472	hsa-miR-486-3p	CLIP-seq
MIRT1289473	hsa-miR-495	CLIP-seq
MIRT1289474	hsa-miR-548ac	CLIP-seq
MIRT1289475	hsa-miR-548ae	CLIP-seq
MIRT1289476	hsa-miR-548aj	CLIP-seq
MIRT1289477	hsa-miR-548am	CLIP-seq
MIRT1289478	hsa-miR-548d-3p	CLIP-seq
MIRT1289479	hsa-miR-548x	CLIP-seq
MIRT1289480	hsa-miR-548z	CLIP-seq
MIRT1289481	hsa-miR-583	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005092	Function	GDP-dissociation inhibitor activity	IMP	7616957
GO:0005096	Function	GTPase activator activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	7616957, 16428860
GO:0005634	Component	Nucleus	TAS	16130169
GO:0005635	Component	Nuclear envelope	TAS
GO:0005643	Component	Nuclear pore	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	25743254
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0007165	Process	Signal transduction	TAS	16130169
GO:0016032	Process	Viral process	TAS
GO:0043547	Process	Positive regulation of GTPase activity	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046604	Process	Positive regulation of mitotic centrosome separation	IBA	21873635
GO:0046907	Process	Intracellular transport	IEA

MIM	HGNC	e!Ensembl
601180	9847	ENSG00000099901

Protein

UniProt ID

P43487

Protein name

Ran-specific GTPase-activating protein (Ran-binding protein 1) (RanBP1)

Protein function

Plays a role in RAN-dependent nucleocytoplasmic transport. Alleviates the TNPO1-dependent inhibition of RAN GTPase activity and mediates the dissociation of RAN from proteins involved in transport into the nucleus (By similarity). Induces a conf

PDB

1K5D , 1K5G

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00638	Ran_BP1	37 → 161	RanBP1 domain	Domain

Sequence

MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
ENDLPEWKERGTGDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKV
AEKLEALSVKEETKEDAEEKQ

Sequence length

201

Interactions

View interactions

	KEGG		Reactome
	Human T-cell leukemia virus 1 infection Viral carcinogenesis		Rev-mediated nuclear export of HIV RNA

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Autism Spectrum Disorder	Associate	26781481
Carcinoma Hepatocellular	Associate	39457014
Colorectal Neoplasms	Associate	34201061
DiGeorge Syndrome	Associate	26781481
Glioma	Associate	37047826
Hyperglycemia	Associate	40018934
Infections	Associate	26745502
Lung Neoplasms	Associate	37047826
Neoplasm Metastasis	Associate	22832492, 37047826
Neoplasms	Associate	37047826
Stomach Neoplasms	Inhibit	26745502

RANBP1 (RAN binding protein 1)