Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5890
Gene name	RAD51 paralog B
Gene symbol	RAD51B
Synonyms (NCBI Gene)	R51H2RAD51L1REC2
Chromosome	14
Chromosome location	14q24.1
Summary	The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the fa

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28908468	C>G	Drug-response	Intron variant, genic downstream transcript variant, coding sequence variant, missense variant
rs764896402	G>A	Likely-pathogenic	5 prime UTR variant, synonymous variant, coding sequence variant

167

Show/Hide all (167)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041780	hsa-miR-484	CLASH	23622248
MIRT449236	hsa-miR-4506	PAR-CLIP	22100165
MIRT449234	hsa-miR-4496	PAR-CLIP	22100165
MIRT449233	hsa-miR-6871-5p	PAR-CLIP	22100165
MIRT449232	hsa-miR-766-5p	PAR-CLIP	22100165
MIRT449231	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT449230	hsa-miR-149-3p	PAR-CLIP	22100165
MIRT449229	hsa-miR-4728-5p	PAR-CLIP	22100165
MIRT449228	hsa-miR-6785-5p	PAR-CLIP	22100165
MIRT449227	hsa-miR-6883-5p	PAR-CLIP	22100165
MIRT449226	hsa-miR-6799-5p	PAR-CLIP	22100165
MIRT449225	hsa-miR-569	PAR-CLIP	22100165
MIRT449224	hsa-miR-1273h-5p	PAR-CLIP	22100165
MIRT449222	hsa-miR-30b-3p	PAR-CLIP	22100165
MIRT449223	hsa-miR-3689a-3p	PAR-CLIP	22100165
MIRT449221	hsa-miR-3689b-3p	PAR-CLIP	22100165
MIRT449220	hsa-miR-3689c	PAR-CLIP	22100165
MIRT449219	hsa-miR-6779-5p	PAR-CLIP	22100165
MIRT449218	hsa-miR-6780a-5p	PAR-CLIP	22100165
MIRT449217	hsa-miR-2053	PAR-CLIP	22100165
MIRT449215	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT449236	hsa-miR-4506	PAR-CLIP	22100165
MIRT449234	hsa-miR-4496	PAR-CLIP	22100165
MIRT449233	hsa-miR-6871-5p	PAR-CLIP	22100165
MIRT449232	hsa-miR-766-5p	PAR-CLIP	22100165
MIRT449231	hsa-miR-7106-5p	PAR-CLIP	22100165
MIRT449230	hsa-miR-149-3p	PAR-CLIP	22100165
MIRT449229	hsa-miR-4728-5p	PAR-CLIP	22100165
MIRT449228	hsa-miR-6785-5p	PAR-CLIP	22100165
MIRT449227	hsa-miR-6883-5p	PAR-CLIP	22100165
MIRT449226	hsa-miR-6799-5p	PAR-CLIP	22100165
MIRT449225	hsa-miR-569	PAR-CLIP	22100165
MIRT449224	hsa-miR-1273h-5p	PAR-CLIP	22100165
MIRT449222	hsa-miR-30b-3p	PAR-CLIP	22100165
MIRT449223	hsa-miR-3689a-3p	PAR-CLIP	22100165
MIRT449221	hsa-miR-3689b-3p	PAR-CLIP	22100165
MIRT449220	hsa-miR-3689c	PAR-CLIP	22100165
MIRT449219	hsa-miR-6779-5p	PAR-CLIP	22100165
MIRT449218	hsa-miR-6780a-5p	PAR-CLIP	22100165
MIRT449217	hsa-miR-2053	PAR-CLIP	22100165
MIRT449215	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT1288042	hsa-miR-3065-5p	CLIP-seq
MIRT1288043	hsa-miR-3973	CLIP-seq
MIRT1288044	hsa-miR-509-3p	CLIP-seq
MIRT1288045	hsa-miR-541	CLIP-seq
MIRT1288046	hsa-miR-629	CLIP-seq
MIRT1288047	hsa-miR-654-5p	CLIP-seq
MIRT1288048	hsa-miR-1208	CLIP-seq
MIRT1288049	hsa-miR-1224-3p	CLIP-seq
MIRT1288050	hsa-miR-1283	CLIP-seq
MIRT1288051	hsa-miR-1291	CLIP-seq
MIRT1288052	hsa-miR-1297	CLIP-seq
MIRT1288053	hsa-miR-137	CLIP-seq
MIRT1288054	hsa-miR-194	CLIP-seq
MIRT1288055	hsa-miR-204	CLIP-seq
MIRT1288056	hsa-miR-21	CLIP-seq
MIRT1288057	hsa-miR-211	CLIP-seq
MIRT1288058	hsa-miR-2117	CLIP-seq
MIRT1288059	hsa-miR-224	CLIP-seq
MIRT1288060	hsa-miR-25	CLIP-seq
MIRT1288061	hsa-miR-26a	CLIP-seq
MIRT1288062	hsa-miR-26b	CLIP-seq
MIRT1288063	hsa-miR-3136-5p	CLIP-seq
MIRT1288064	hsa-miR-3143	CLIP-seq
MIRT1288065	hsa-miR-3155	CLIP-seq
MIRT1288066	hsa-miR-3155b	CLIP-seq
MIRT1288067	hsa-miR-32	CLIP-seq
MIRT1288068	hsa-miR-328	CLIP-seq
MIRT1288069	hsa-miR-3613-3p	CLIP-seq
MIRT1288070	hsa-miR-363	CLIP-seq
MIRT1288071	hsa-miR-3663-5p	CLIP-seq
MIRT1288072	hsa-miR-3667-3p	CLIP-seq
MIRT1288073	hsa-miR-367	CLIP-seq
MIRT1288074	hsa-miR-3677-5p	CLIP-seq
MIRT1288075	hsa-miR-3714	CLIP-seq
MIRT1288076	hsa-miR-3922-5p	CLIP-seq
MIRT1288077	hsa-miR-4273	CLIP-seq
MIRT1288078	hsa-miR-4287	CLIP-seq
MIRT1288079	hsa-miR-4325	CLIP-seq
MIRT1288080	hsa-miR-4439	CLIP-seq
MIRT1288081	hsa-miR-4446-5p	CLIP-seq
MIRT1288082	hsa-miR-4465	CLIP-seq
MIRT1288083	hsa-miR-4513	CLIP-seq
MIRT1288084	hsa-miR-4540	CLIP-seq
MIRT1288085	hsa-miR-4659a-3p	CLIP-seq
MIRT1288086	hsa-miR-4659b-3p	CLIP-seq
MIRT1288087	hsa-miR-4677-5p	CLIP-seq
MIRT1288088	hsa-miR-4685-3p	CLIP-seq
MIRT1288089	hsa-miR-4742-5p	CLIP-seq
MIRT1288090	hsa-miR-4755-5p	CLIP-seq
MIRT1288091	hsa-miR-4756-3p	CLIP-seq
MIRT1288092	hsa-miR-4764-5p	CLIP-seq
MIRT1288093	hsa-miR-4778-3p	CLIP-seq
MIRT1288094	hsa-miR-4780	CLIP-seq
MIRT1288095	hsa-miR-4786-5p	CLIP-seq
MIRT1288096	hsa-miR-4789-5p	CLIP-seq
MIRT1288097	hsa-miR-510	CLIP-seq
MIRT1288098	hsa-miR-543	CLIP-seq
MIRT1288099	hsa-miR-590-5p	CLIP-seq
MIRT1288100	hsa-miR-623	CLIP-seq
MIRT1288101	hsa-miR-769-5p	CLIP-seq
MIRT1288102	hsa-miR-92a	CLIP-seq
MIRT1288103	hsa-miR-92b	CLIP-seq
MIRT1288104	hsa-miR-940	CLIP-seq
MIRT1288105	hsa-miR-943	CLIP-seq
MIRT1288106	hsa-miR-1254	CLIP-seq
MIRT1288107	hsa-miR-1273g	CLIP-seq
MIRT1288108	hsa-miR-1304	CLIP-seq
MIRT1288109	hsa-miR-130a	CLIP-seq
MIRT1288110	hsa-miR-130b	CLIP-seq
MIRT1288111	hsa-miR-1537	CLIP-seq
MIRT1288112	hsa-miR-18a	CLIP-seq
MIRT1288113	hsa-miR-18b	CLIP-seq
MIRT1288114	hsa-miR-19a	CLIP-seq
MIRT1288115	hsa-miR-19b	CLIP-seq
MIRT1288116	hsa-miR-301a	CLIP-seq
MIRT1288117	hsa-miR-301b	CLIP-seq
MIRT1288118	hsa-miR-302a	CLIP-seq
MIRT1288119	hsa-miR-302b	CLIP-seq
MIRT1288120	hsa-miR-302c	CLIP-seq
MIRT1288121	hsa-miR-302d	CLIP-seq
MIRT1288122	hsa-miR-302e	CLIP-seq
MIRT1288123	hsa-miR-3116	CLIP-seq
MIRT1288124	hsa-miR-3666	CLIP-seq
MIRT1288125	hsa-miR-372	CLIP-seq
MIRT1288126	hsa-miR-373	CLIP-seq
MIRT1288127	hsa-miR-410	CLIP-seq
MIRT1288128	hsa-miR-4295	CLIP-seq
MIRT1288129	hsa-miR-454	CLIP-seq
MIRT1288130	hsa-miR-4735-3p	CLIP-seq
MIRT1288131	hsa-miR-4795-3p	CLIP-seq
MIRT1288132	hsa-miR-488	CLIP-seq
MIRT1288133	hsa-miR-519a	CLIP-seq
MIRT1288134	hsa-miR-519b-3p	CLIP-seq
MIRT1288135	hsa-miR-519c-3p	CLIP-seq
MIRT1288136	hsa-miR-520a-3p	CLIP-seq
MIRT1288137	hsa-miR-520b	CLIP-seq
MIRT1288138	hsa-miR-520c-3p	CLIP-seq
MIRT1288139	hsa-miR-520d-3p	CLIP-seq
MIRT1288140	hsa-miR-520e	CLIP-seq
MIRT1288141	hsa-miR-550a	CLIP-seq
MIRT1288142	hsa-miR-563	CLIP-seq
MIRT1288143	hsa-miR-661	CLIP-seq
MIRT1288144	hsa-miR-944	CLIP-seq
MIRT2085302	hsa-miR-325	CLIP-seq
MIRT2085303	hsa-miR-4453	CLIP-seq
MIRT2085304	hsa-miR-4538	CLIP-seq
MIRT2085305	hsa-miR-576-3p	CLIP-seq
MIRT2085306	hsa-miR-628-3p	CLIP-seq
MIRT2085307	hsa-miR-635	CLIP-seq
MIRT2310745	hsa-miR-1267	CLIP-seq
MIRT2310746	hsa-miR-135a	CLIP-seq
MIRT2310747	hsa-miR-135b	CLIP-seq
MIRT2310748	hsa-miR-3913-3p	CLIP-seq
MIRT2310749	hsa-miR-4687-3p	CLIP-seq
MIRT1288131	hsa-miR-4795-3p	CLIP-seq
MIRT2310750	hsa-miR-489	CLIP-seq
MIRT1288144	hsa-miR-944	CLIP-seq
MIRT2393410	hsa-miR-1293	CLIP-seq
MIRT2393411	hsa-miR-3122	CLIP-seq
MIRT2393412	hsa-miR-3913-5p	CLIP-seq
MIRT2393413	hsa-miR-3929	CLIP-seq
MIRT2393414	hsa-miR-4419b	CLIP-seq
MIRT2393415	hsa-miR-4478	CLIP-seq
MIRT2393416	hsa-miR-4483	CLIP-seq
MIRT2393417	hsa-miR-485-5p	CLIP-seq
MIRT2393418	hsa-miR-500a	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
GTF3A	Unknown	9878257
TP53	Unknown	9878257

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000400	Function	Four-way junction DNA binding	IBA
GO:0000400	Function	Four-way junction DNA binding	IDA	20207730
GO:0000724	Process	Double-strand break repair via homologous recombination	IBA
GO:0000724	Process	Double-strand break repair via homologous recombination	IEA
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	23149936
GO:0001701	Process	In utero embryonic development	IEA
GO:0001832	Process	Blastocyst growth	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	9512535
GO:0003690	Function	Double-stranded DNA binding	IBA
GO:0003690	Function	Double-stranded DNA binding	IDA	12441335
GO:0003697	Function	Single-stranded DNA binding	IBA
GO:0003697	Function	Single-stranded DNA binding	IDA	12441335
GO:0005515	Function	Protein binding	IPI	9469824, 11751635, 11842113, 21965664, 24141787, 25416956, 28864920, 32296183, 33961781, 34591612
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9512535
GO:0005654	Component	Nucleoplasm	TAS
GO:0005657	Component	Replication fork	IBA
GO:0005657	Component	Replication fork	IDA	20207730
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	TAS	9512535
GO:0006310	Process	DNA recombination	IEA
GO:0006310	Process	DNA recombination	TAS	9512535
GO:0006974	Process	DNA damage response	IEA
GO:0007131	Process	Reciprocal meiotic recombination	TAS	9441753
GO:0008094	Function	ATP-dependent activity, acting on DNA	IBA
GO:0008094	Function	ATP-dependent activity, acting on DNA	IDA	12441335
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IMP	23108668
GO:0033063	Component	Rad51B-Rad51C-Rad51D-XRCC2 complex	IDA	11751635
GO:0033063	Component	Rad51B-Rad51C-Rad51D-XRCC2 complex	IEA
GO:0061053	Process	Somite development	IEA
GO:0140664	Function	ATP-dependent DNA damage sensor activity	IEA

MIM	HGNC	e!Ensembl
602948	9822	ENSG00000182185

O15315

Protein name

DNA repair protein RAD51 homolog 2 (R51H2) (RAD51 homolog B) (Rad51B) (RAD51-like protein 1)

Protein function

Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. Binds single-str

PDB

8FAZ , 8GBJ , 8OUY , 8OUZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08423	Rad51	42 → 344	Rad51	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide range of tissues.

Sequence

MGSKKLKRVGLSQELCDRLSRHQILTCQDFLCLSPLELMKVTGLSYRGVHELLCMVSRAC
APKMQTAYGIKAQRSADFSPAFLSTTLSALDEALHGGVACGSLTEITGPPGCGKTQFCIM
MSILATLPTNMGGLEGAVVYIDTESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLY
RELTCDEVLQRIESLEEEIISKGIKLVILDSVASVVRKEFDAQLQGNLKERNKFLAREAS
SLKYLAEEFSIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTW
SHSVNTRLILQYLDSERRQILIAKSPLAPFTSFVYTIKEEGLVLQETTFCSVTQAELNWA
PEILPPQPPEQLGLQMCHHTQLIF

Sequence length

384

Interactions

View interactions

	KEGG		Reactome
	Homologous recombination		HDR through Homologous Recombination (HRR) Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA) Resolution of D-loop Structures through Holliday Junction Intermediates Homologous DNA Pairing and Strand Exchange Presynaptic phase of homologous DNA pairing and strand exchange Factors involved in megakaryocyte development and platelet production

134

Show/Hide Unknown Diseases (26)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign; Likely benign; Conflicting classifications of pathogenicity	rs34594234, rs148518198	RCV005929918 RCV005901753
Adrenocortical carcinoma, hereditary	Benign; Likely benign	rs34594234	RCV005929921
Cervical cancer	Benign; Likely benign	rs34594234, rs34436700	RCV005929922 RCV005893829
Clear cell carcinoma of kidney	Benign; Likely benign	rs34594234	RCV005929923
Colon adenocarcinoma	Benign; Likely benign; Conflicting classifications of pathogenicity	rs34594234, rs148518198	RCV005929917 RCV005901752
Diffuse pediatric-type high-grade glioma, H3-wildtype and IDH-wildtype	Uncertain significance	rs1410470158	RCV003325262
Familial cancer of breast	Uncertain significance	rs200355697	RCV004596113
Gastric cancer	Benign; Likely benign	rs2074565, rs34594234	RCV005915739 RCV005929926
Hereditary breast ovarian cancer syndrome	Benign; Uncertain significance; Likely benign; Conflicting classifications of pathogenicity	rs35183950, rs10129646, rs184815928, rs35080917, rs17783124, rs1474939, rs34094401, rs200741476, rs375203676, rs34343730, rs755033108, rs548280411, rs140423456, rs149154702, rs34594234 View all (23 more)	RCV002225879 RCV002225888 RCV002225894 RCV002225905 RCV002225910 RCV002225908 RCV002225909 RCV002226258 RCV002226259 RCV002226260 RCV002226261 RCV002226262 RCV002226263 RCV002226264 RCV002226265 RCV002226266 RCV002226267 RCV002226268 RCV002226269 RCV002226270 RCV002226271 RCV002226272 RCV002226273 RCV002226274 RCV002226275 RCV002226276 RCV002226277 RCV000416925 RCV002225696 RCV002225720 RCV002225769 RCV002225763 RCV002225761 RCV002225766 RCV001030514 RCV001030515 RCV001030580 RCV001030581
Hereditary cancer	Conflicting classifications of pathogenicity	rs148518198	RCV005231301
Hereditary cancer-predisposing syndrome	Benign; Conflicting classifications of pathogenicity; Likely benign; Uncertain significance	rs10129646, rs17783124, rs764896402, rs34436700, rs117190791, rs184721768, rs574178911, rs556371643, rs117405447, rs533348490, rs200355697, rs753393344, rs1009774288, rs34583846, rs190059291 View all (5 more)	RCV005629638 RCV005629650 RCV000708628 RCV000208920 RCV000209247 RCV000209693 RCV000209058 RCV000209385 RCV000209596 RCV000209097 RCV000210105 RCV000210170 RCV000708744 RCV000708742 RCV000708741 RCV000708743 RCV000708745 RCV000708746 RCV000708739 RCV000708740
Lung cancer	Benign; Likely benign; -	rs34594234, rs368278073	RCV005929932 RCV005930677
Malignant lymphoma, large B-cell, diffuse	Benign	rs2074565	RCV005915738
Malignant tumor of esophagus	Benign; Likely benign	rs34594234	RCV005929919
Melanoma	Benign; Likely benign	rs34594234	RCV005929931
Nonpapillary renal cell carcinoma	Benign; Likely benign	rs34594234	RCV005929920
Ovarian serous cystadenocarcinoma	Benign; Likely benign	rs34594234	RCV005929927
Poly (ADP-Ribose) polymerase inhibitor response	Benign; Likely benign	rs28908468	RCV000626451
RAD51B-related disorder	Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity	rs548280411, rs745505141, rs181459801, rs199981178, rs116719491, rs11321834, rs773861877, rs1159240971, rs61758785, rs28910275	RCV003926331 RCV003906746 RCV003919117 RCV003909326 RCV003919733 RCV003906931 RCV003973926 RCV003974029 RCV003899418 RCV003917055 RCV003917085 RCV003919484 RCV003939433 RCV003939423 RCV003944764 RCV003922018 RCV003926953 RCV003946902 RCV003956738 RCV003962284 RCV003976572 RCV003976635 RCV003907962 RCV003940448
Sarcoma	Benign; Likely benign	rs34594234, rs34436700	RCV005929925 RCV005893830
Squamous cell lung carcinoma	-	rs1464701988	RCV005929880
Thymoma	Benign; Likely benign	rs34594234	RCV005929929
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	rs34594234	RCV005929930
Uterine carcinosarcoma	Benign; Likely benign	rs2074565, rs34594234	RCV005915740 RCV005929928
Uterine corpus endometrial carcinoma	Benign; Likely benign	rs34594234	RCV005929933
Uveal melanoma	Benign; Likely benign	rs34594234	RCV005929924

Show/Hide Text Mining Associations (48)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Aneuploidy	Stimulate	27651161
Arthritis Rheumatoid	Associate	24532676, 28361912, 36835215
Asthma	Associate	31095684
Brain Neoplasms	Associate	37878192
Breast Neoplasms	Associate	19330030, 21593217, 21791674, 21844186, 21852249, 21959381, 22232737, 22313133, 22454379, 23190577, 23593120, 23635555, 24139550, 24325915, 24729084 View all (12 more)
Breast Neoplasms Male	Associate	23001122, 27149063
Carcinogenesis	Inhibit	12441335
Carcinoma Ovarian Epithelial	Associate	24190013, 26261251
Carcinoma Pancreatic Ductal	Associate	35737913
Carcinoma Squamous Cell	Associate	32098697
Colorectal Neoplasms	Associate	35567913
Corneal Neovascularization	Associate	24498017
Fanconi Anemia	Associate	31584931
Geographic Atrophy	Associate	24498017
Glioma	Associate	20610542
Glycogen Storage Disease Type II	Associate	24498017
Gynecomastia	Associate	32295201
Hereditary Breast and Ovarian Cancer Syndrome	Associate	24139550, 29255180, 30535121, 33099839
Inflammation	Associate	27683114
Leiomyoma	Associate	23738515, 26787895
Leiomyosarcoma	Associate	28514723, 38141829
Leukemia	Associate	37286545
Lymphatic Metastasis	Associate	27651161
Macular Degeneration	Associate	23455636, 24526414, 26961928, 30535121, 31191752
Nasopharyngeal Carcinoma	Associate	21368091
Neoplasms	Associate	21852249, 26637267, 27467053, 27683114, 30489320, 31584931, 32234758, 32295201, 37344587, 37932833, 38141829, 38417742, 40421962
Neoplasms	Stimulate	27651161
Neoplasms	Inhibit	32669601
Neoplasms Radiation Induced	Associate	36788076
Ovarian Neoplasms	Associate	26261251, 29255180, 37344587, 38041901
Pancreatic Neoplasms	Associate	39256447
Parkinson Disease	Associate	28117402
Perivascular Epithelioid Cell Neoplasms	Associate	38141829
Pituitary Neoplasms	Associate	33622874
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	37286545
Prostatic Neoplasms	Associate	26339569, 26964030, 32234758
Prostatic Neoplasms Castration Resistant	Associate	35735442
Recombinant chromosome 8 syndrome	Associate	35643464
Rectal Neoplasms	Associate	31209889
Retinal Dysplasia	Associate	32098697
Sarcoma	Associate	38141829
Squamous Cell Carcinoma of Head and Neck	Associate	27683114
Stomach Diseases	Associate	27651161
Stomach Neoplasms	Associate	27651161
T Lymphocytopenia Idiopathic CD4 Positive	Associate	37344587
Tooth Erosion	Associate	28361912
Triple Negative Breast Neoplasms	Associate	21844186, 24325915
Uterine Cervical Neoplasms	Associate	27334422, 27363024

RAD51B (RAD51 paralog B)