Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5887
Gene name Gene Name - the full gene name approved by the HGNC.
RAD23 nucleotide excision repair protein B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RAD23B
Synonyms (NCBI Gene) Gene synonyms aliases
HHR23B, HR23B, P58
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q31.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005172 hsa-miR-30a-5p pSILAC 18668040
MIRT000056 hsa-miR-373-3p Luciferase reporter assay, qRT-PCR, Western blot 19141645
MIRT021032 hsa-miR-155-5p Proteomics 18668040
MIRT005172 hsa-miR-30a-5p Proteomics;Other 18668040
MIRT048988 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000502 Component Proteasome complex IEA
GO:0000715 Process Nucleotide-excision repair, DNA damage recognition IDA 19941824
GO:0000715 Process Nucleotide-excision repair, DNA damage recognition TAS
GO:0000717 Process Nucleotide-excision repair, DNA duplex unwinding TAS
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600062 9813 ENSG00000119318
Protein
UniProt ID P54727
Protein name UV excision repair protein RAD23 homolog B (HR23B) (hHR23B) (XP-C repair-complementing complex 58 kDa protein) (p58)
Protein function Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated
PDB 1P1A , 1PVE , 1UEL , 8EBS , 8EBV , 8EBW
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00240 ubiquitin 3 77 Ubiquitin family Domain
PF00627 UBA 189 225 UBA/TS-N domain Domain
PF09280 XPC-binding 276 332 XPC-binding domain Domain
PF00627 UBA 365 401 UBA/TS-N domain Domain
Sequence
MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALK
EYKIDEKNFVVVMVTKP
KAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPT
STPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDA
TSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVD
PPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
ALLQQIGRENPQLLQQISQHQEHFIQMLNEPV
QEAGGQGGGGGGGSGGIAEAGSGHMNYI
QVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
Sequence length 409
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Nucleotide excision repair
Protein processing in endoplasmic reticulum
  N-glycan trimming in the ER and Calnexin/Calreticulin cycle
Josephin domain DUBs
DNA Damage Recognition in GG-NER
Formation of Incision Complex in GG-NER
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 19208208
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 16712842, 23776089, 36341328, 36835443
Carcinogenesis Associate 12505994
Colorectal Neoplasms Associate 38064496
Connective Tissue Diseases Associate 22208759
Esophageal Neoplasms Stimulate 19270000
Esophageal Neoplasms Associate 19270000
Genetic Diseases Inborn Associate 22208759
Glaucoma Associate 39326071
Heredodegenerative Disorders Nervous System Associate 22208759
Hypoxia Inhibit 19141645