Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5879
Gene name	Rac family small GTPase 1
Gene symbol	RAC1
Synonyms (NCBI Gene)	MIG5MRD48Rac-1TC-25p21-Rac1
Chromosome	7
Chromosome location	7p22.1
Summary	The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorgani

Show/Hide all (8)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057519874	C>A,T	Not-provided, likely-pathogenic	Missense variant, coding sequence variant
rs1057519948	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1554263326	G>A	Pathogenic	Coding sequence variant, missense variant
rs1554263624	A>G	Pathogenic	Coding sequence variant, missense variant
rs1554263625	G>A,C	Pathogenic	Coding sequence variant, missense variant
rs1554263626	T>G	Pathogenic	Coding sequence variant, missense variant
rs1554264268	G>A	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs1583271463	->GT	Likely-pathogenic	Coding sequence variant, frameshift variant

837

Show/Hide all (837)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000663	hsa-miR-122-5p	Luciferase reporter assayReview	19935707
MIRT003540	rno-miR-194-5p	qRT-PCRWestern blot	19892940
MIRT005890	hsa-miR-194-5p	Luciferase reporter assayqRT-PCRWestern blot	20979124
MIRT005890	hsa-miR-194-5p	Luciferase reporter assayqRT-PCRWestern blot	20979124
MIRT006370	hsa-miR-142-3p	GFP reporter assay	21482222
MIRT006370	hsa-miR-142-3p	GFP reporter assay	21482222
MIRT006370	hsa-miR-142-3p	GFP reporter assay	21482222
MIRT006370	hsa-miR-142-3p	GFP reporter assay	21482222
MIRT006370	hsa-miR-142-3p	GFP reporter assay	21482222
MIRT006370	hsa-miR-142-3p	GFP reporter assay	21482222
MIRT020715	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT027282	hsa-miR-101-3p	Sequencing	20371350
MIRT047987	hsa-miR-30c-5p	CLASH	23622248
MIRT039481	hsa-miR-652-3p	CLASH	23622248
MIRT006370	hsa-miR-142-3p	Luciferase reporter assayqRT-PCRWestern blot	24743945
MIRT053025	hsa-miR-124-3p	qRT-PCRWestern blotLuciferase assay	23334332
MIRT054242	hsa-miR-574-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23554959
MIRT438306	hsa-miR-146a-5p	In situ hybridizationWestern blotLuciferase reporter assayqRT-PCR	25214035
MIRT438306	hsa-miR-146a-5p	In situ hybridizationWestern blotLuciferase reporter assayqRT-PCR	25214035
MIRT027282	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT469660	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT469659	hsa-miR-483-3p	PAR-CLIP	20371350
MIRT104080	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT104077	hsa-miR-136-5p	PAR-CLIP	20371350
MIRT027282	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT469658	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT104078	hsa-miR-425-3p	PAR-CLIP	20371350
MIRT027282	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT469660	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT469659	hsa-miR-483-3p	PAR-CLIP	20371350
MIRT104080	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT104077	hsa-miR-136-5p	PAR-CLIP	20371350
MIRT027282	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT469658	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT104078	hsa-miR-425-3p	PAR-CLIP	20371350
MIRT027282	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT469660	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT469659	hsa-miR-483-3p	PAR-CLIP	20371350
MIRT104080	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT104077	hsa-miR-136-5p	PAR-CLIP	20371350
MIRT027282	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT469658	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT104078	hsa-miR-425-3p	PAR-CLIP	20371350
MIRT321047	hsa-miR-5700	PAR-CLIP	20371350
MIRT554974	hsa-miR-624-3p	PAR-CLIP	20371350
MIRT554972	hsa-miR-369-3p	PAR-CLIP	20371350
MIRT554973	hsa-miR-5692b	PAR-CLIP	20371350
MIRT554971	hsa-miR-5692c	PAR-CLIP	20371350
MIRT554970	hsa-miR-300	PAR-CLIP	20371350
MIRT554969	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT321046	hsa-miR-2115-3p	PAR-CLIP	20371350
MIRT321044	hsa-miR-586	PAR-CLIP	20371350
MIRT554968	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT554967	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT321042	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT321045	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT321041	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT321043	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT321047	hsa-miR-5700	PAR-CLIP	21572407
MIRT554974	hsa-miR-624-3p	PAR-CLIP	21572407
MIRT554972	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT554973	hsa-miR-5692b	PAR-CLIP	21572407
MIRT554971	hsa-miR-5692c	PAR-CLIP	21572407
MIRT554970	hsa-miR-300	PAR-CLIP	21572407
MIRT554969	hsa-miR-381-3p	PAR-CLIP	21572407
MIRT321046	hsa-miR-2115-3p	PAR-CLIP	21572407
MIRT321044	hsa-miR-586	PAR-CLIP	21572407
MIRT554968	hsa-miR-374c-5p	PAR-CLIP	21572407
MIRT554967	hsa-miR-655-3p	PAR-CLIP	21572407
MIRT321042	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT321045	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT321041	hsa-miR-361-5p	PAR-CLIP	21572407
MIRT321043	hsa-miR-374a-3p	PAR-CLIP	21572407
MIRT554966	hsa-miR-576-5p	PAR-CLIP	21572407
MIRT027282	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT469660	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT469659	hsa-miR-483-3p	PAR-CLIP	21572407
MIRT104080	hsa-miR-885-5p	PAR-CLIP	21572407
MIRT104077	hsa-miR-136-5p	PAR-CLIP	21572407
MIRT027282	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT469658	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT104078	hsa-miR-425-3p	PAR-CLIP	21572407
MIRT027282	hsa-miR-101-3p	PAR-CLIP	23446348
MIRT469660	hsa-miR-144-3p	PAR-CLIP	23446348
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT469659	hsa-miR-483-3p	PAR-CLIP	23446348
MIRT104080	hsa-miR-885-5p	PAR-CLIP	23446348
MIRT104077	hsa-miR-136-5p	PAR-CLIP	23446348
MIRT027282	hsa-miR-101-3p	PAR-CLIP	23446348
MIRT469658	hsa-miR-582-5p	PAR-CLIP	23446348
MIRT104078	hsa-miR-425-3p	PAR-CLIP	23446348
MIRT362767	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT362774	hsa-miR-3934-5p	PAR-CLIP	23446348
MIRT362773	hsa-miR-3665	PAR-CLIP	23446348
MIRT505960	hsa-miR-4720-3p	PAR-CLIP	23446348
MIRT362777	hsa-miR-6124	PAR-CLIP	23446348
MIRT362769	hsa-miR-1207-5p	PAR-CLIP	23446348
MIRT362776	hsa-miR-4763-3p	PAR-CLIP	23446348
MIRT362775	hsa-miR-4736	PAR-CLIP	23446348
MIRT362778	hsa-miR-7150	PAR-CLIP	23446348
MIRT469656	hsa-miR-3686	PAR-CLIP	23446348
MIRT027282	hsa-miR-101-3p	PAR-CLIP	24398324
MIRT469660	hsa-miR-144-3p	PAR-CLIP	24398324
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	24398324
MIRT469659	hsa-miR-483-3p	PAR-CLIP	24398324
MIRT104080	hsa-miR-885-5p	PAR-CLIP	24398324
MIRT104077	hsa-miR-136-5p	PAR-CLIP	24398324
MIRT027282	hsa-miR-101-3p	PAR-CLIP	24398324
MIRT469658	hsa-miR-582-5p	PAR-CLIP	24398324
MIRT104078	hsa-miR-425-3p	PAR-CLIP	24398324
MIRT027282	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT469660	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT469659	hsa-miR-483-3p	PAR-CLIP	23592263
MIRT104080	hsa-miR-885-5p	PAR-CLIP	23592263
MIRT104077	hsa-miR-136-5p	PAR-CLIP	23592263
MIRT027282	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT469658	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT104078	hsa-miR-425-3p	PAR-CLIP	23592263
MIRT362767	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT362774	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT469657	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT362773	hsa-miR-3665	PAR-CLIP	23592263
MIRT362777	hsa-miR-6124	PAR-CLIP	23592263
MIRT362769	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT362776	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT362775	hsa-miR-4736	PAR-CLIP	23592263
MIRT362778	hsa-miR-7150	PAR-CLIP	23592263
MIRT469656	hsa-miR-3686	PAR-CLIP	23592263
MIRT222453	hsa-miR-365a-3p	PAR-CLIP	23592263
MIRT222454	hsa-miR-365b-3p	PAR-CLIP	23592263
MIRT362771	hsa-miR-3612	PAR-CLIP	23592263
MIRT362766	hsa-miR-650	PAR-CLIP	23592263
MIRT362772	hsa-miR-3622b-5p	PAR-CLIP	23592263
MIRT469655	hsa-miR-3175	PAR-CLIP	23592263
MIRT469654	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT469653	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT222458	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT222452	hsa-miR-183-3p	PAR-CLIP	23592263
MIRT469652	hsa-miR-2110	PAR-CLIP	23592263
MIRT469651	hsa-miR-6810-5p	PAR-CLIP	23592263
MIRT222456	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT222457	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT469650	hsa-miR-6857-5p	PAR-CLIP	23592263
MIRT222455	hsa-miR-450a-2-3p	PAR-CLIP	23592263
MIRT469649	hsa-miR-4260	PAR-CLIP	23592263
MIRT469647	hsa-miR-5572	PAR-CLIP	23592263
MIRT006370	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT020715	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT006370	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT020715	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT222459	hsa-miR-142-5p	Western blotLuciferase reporter assay	25530132
MIRT000663	hsa-miR-122-5p	MicroarrayqRT-PCRWestern blot	26540468
MIRT027282	hsa-miR-101-3p	Luciferase reporter assayqRT-PCRWestern blot	28109909
MIRT736186	hsa-miR-224-5p	Luciferase reporter assay	27222381
MIRT736186	hsa-miR-224-5p	Luciferase reporter assay	27222381
MIRT027282	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027282	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT362769	hsa-miR-1207-5p	PAR-CLIP	26701625
MIRT104077	hsa-miR-136-5p	PAR-CLIP	26701625
MIRT104077	hsa-miR-136-5p	PAR-CLIP	26701625
MIRT469660	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT469660	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT362773	hsa-miR-3665	PAR-CLIP	26701625
MIRT469656	hsa-miR-3686	PAR-CLIP	26701625
MIRT362774	hsa-miR-3934-5p	PAR-CLIP	26701625
MIRT104078	hsa-miR-425-3p	PAR-CLIP	26701625
MIRT104078	hsa-miR-425-3p	PAR-CLIP	26701625
MIRT362775	hsa-miR-4736	PAR-CLIP	26701625
MIRT362776	hsa-miR-4763-3p	PAR-CLIP	26701625
MIRT469659	hsa-miR-483-3p	PAR-CLIP	26701625
MIRT469658	hsa-miR-582-5p	PAR-CLIP	26701625
MIRT469658	hsa-miR-582-5p	PAR-CLIP	26701625
MIRT362777	hsa-miR-6124	PAR-CLIP	26701625
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	26701625
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	26701625
MIRT362767	hsa-miR-651-3p	PAR-CLIP	26701625
MIRT362778	hsa-miR-7150	PAR-CLIP	26701625
MIRT104080	hsa-miR-885-5p	PAR-CLIP	26701625
MIRT104080	hsa-miR-885-5p	PAR-CLIP	26701625
MIRT733952	hsa-miR-200b-3p	ImmunofluorescenceImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCRWestern blotting	33122632
MIRT733953	hsa-miR-200c-3p	ImmunofluorescenceImmunohistochemistry (IHC)Luciferase reporter assayqRT-PCRWestern blotting	33122632
MIRT736186	hsa-miR-224-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	31897093
MIRT736186	hsa-miR-224-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	31897093
MIRT438306	hsa-miR-146a-5p	Luciferase reporter assayWestern blottingqRT-PCR	31960423
MIRT006370	hsa-miR-142-3p	Western blotting	34109430
MIRT027282	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT469660	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT469659	hsa-miR-483-3p	PAR-CLIP	20371350
MIRT104080	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT104077	hsa-miR-136-5p	PAR-CLIP	20371350
MIRT027282	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT469658	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT104078	hsa-miR-425-3p	PAR-CLIP	20371350
MIRT027282	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT469660	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT469659	hsa-miR-483-3p	PAR-CLIP	20371350
MIRT104080	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT104077	hsa-miR-136-5p	PAR-CLIP	20371350
MIRT027282	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT469658	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT104078	hsa-miR-425-3p	PAR-CLIP	20371350
MIRT027282	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT469660	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT469659	hsa-miR-483-3p	PAR-CLIP	20371350
MIRT104080	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT104077	hsa-miR-136-5p	PAR-CLIP	20371350
MIRT027282	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT469658	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT104078	hsa-miR-425-3p	PAR-CLIP	20371350
MIRT321047	hsa-miR-5700	PAR-CLIP	20371350
MIRT554974	hsa-miR-624-3p	PAR-CLIP	20371350
MIRT554972	hsa-miR-369-3p	PAR-CLIP	20371350
MIRT554973	hsa-miR-5692b	PAR-CLIP	20371350
MIRT554971	hsa-miR-5692c	PAR-CLIP	20371350
MIRT554970	hsa-miR-300	PAR-CLIP	20371350
MIRT554969	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT321046	hsa-miR-2115-3p	PAR-CLIP	20371350
MIRT321044	hsa-miR-586	PAR-CLIP	20371350
MIRT554968	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT554967	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT321042	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT321045	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT321041	hsa-miR-361-5p	PAR-CLIP	20371350
MIRT321043	hsa-miR-374a-3p	PAR-CLIP	20371350
MIRT321047	hsa-miR-5700	PAR-CLIP	21572407
MIRT554974	hsa-miR-624-3p	PAR-CLIP	21572407
MIRT554972	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT554973	hsa-miR-5692b	PAR-CLIP	21572407
MIRT554971	hsa-miR-5692c	PAR-CLIP	21572407
MIRT554970	hsa-miR-300	PAR-CLIP	21572407
MIRT554969	hsa-miR-381-3p	PAR-CLIP	21572407
MIRT321046	hsa-miR-2115-3p	PAR-CLIP	21572407
MIRT321044	hsa-miR-586	PAR-CLIP	21572407
MIRT554968	hsa-miR-374c-5p	PAR-CLIP	21572407
MIRT554967	hsa-miR-655-3p	PAR-CLIP	21572407
MIRT321042	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT321045	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT321041	hsa-miR-361-5p	PAR-CLIP	21572407
MIRT321043	hsa-miR-374a-3p	PAR-CLIP	21572407
MIRT554966	hsa-miR-576-5p	PAR-CLIP	21572407
MIRT027282	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT469660	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT469659	hsa-miR-483-3p	PAR-CLIP	21572407
MIRT104080	hsa-miR-885-5p	PAR-CLIP	21572407
MIRT104077	hsa-miR-136-5p	PAR-CLIP	21572407
MIRT027282	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT469658	hsa-miR-582-5p	PAR-CLIP	21572407
MIRT104078	hsa-miR-425-3p	PAR-CLIP	21572407
MIRT027282	hsa-miR-101-3p	PAR-CLIP	23446348
MIRT469660	hsa-miR-144-3p	PAR-CLIP	23446348
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT469659	hsa-miR-483-3p	PAR-CLIP	23446348
MIRT104080	hsa-miR-885-5p	PAR-CLIP	23446348
MIRT104077	hsa-miR-136-5p	PAR-CLIP	23446348
MIRT027282	hsa-miR-101-3p	PAR-CLIP	23446348
MIRT469658	hsa-miR-582-5p	PAR-CLIP	23446348
MIRT104078	hsa-miR-425-3p	PAR-CLIP	23446348
MIRT362767	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT362774	hsa-miR-3934-5p	PAR-CLIP	23446348
MIRT362773	hsa-miR-3665	PAR-CLIP	23446348
MIRT505960	hsa-miR-4720-3p	PAR-CLIP	23446348
MIRT362777	hsa-miR-6124	PAR-CLIP	23446348
MIRT362769	hsa-miR-1207-5p	PAR-CLIP	23446348
MIRT362776	hsa-miR-4763-3p	PAR-CLIP	23446348
MIRT362775	hsa-miR-4736	PAR-CLIP	23446348
MIRT362778	hsa-miR-7150	PAR-CLIP	23446348
MIRT469656	hsa-miR-3686	PAR-CLIP	23446348
MIRT027282	hsa-miR-101-3p	PAR-CLIP	24398324
MIRT469660	hsa-miR-144-3p	PAR-CLIP	24398324
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	24398324
MIRT469659	hsa-miR-483-3p	PAR-CLIP	24398324
MIRT104080	hsa-miR-885-5p	PAR-CLIP	24398324
MIRT104077	hsa-miR-136-5p	PAR-CLIP	24398324
MIRT027282	hsa-miR-101-3p	PAR-CLIP	24398324
MIRT469658	hsa-miR-582-5p	PAR-CLIP	24398324
MIRT104078	hsa-miR-425-3p	PAR-CLIP	24398324
MIRT027282	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT469660	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT104082	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT469659	hsa-miR-483-3p	PAR-CLIP	23592263
MIRT104080	hsa-miR-885-5p	PAR-CLIP	23592263
MIRT104077	hsa-miR-136-5p	PAR-CLIP	23592263
MIRT027282	hsa-miR-101-3p	PAR-CLIP	23592263
MIRT469658	hsa-miR-582-5p	PAR-CLIP	23592263
MIRT104078	hsa-miR-425-3p	PAR-CLIP	23592263
MIRT362767	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT362774	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT469657	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT362773	hsa-miR-3665	PAR-CLIP	23592263
MIRT362777	hsa-miR-6124	PAR-CLIP	23592263
MIRT362769	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT362776	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT362775	hsa-miR-4736	PAR-CLIP	23592263
MIRT362778	hsa-miR-7150	PAR-CLIP	23592263
MIRT469656	hsa-miR-3686	PAR-CLIP	23592263
MIRT222453	hsa-miR-365a-3p	PAR-CLIP	23592263
MIRT222454	hsa-miR-365b-3p	PAR-CLIP	23592263
MIRT362771	hsa-miR-3612	PAR-CLIP	23592263
MIRT362766	hsa-miR-650	PAR-CLIP	23592263
MIRT362772	hsa-miR-3622b-5p	PAR-CLIP	23592263
MIRT469655	hsa-miR-3175	PAR-CLIP	23592263
MIRT469654	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT469653	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT222458	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT222452	hsa-miR-183-3p	PAR-CLIP	23592263
MIRT469652	hsa-miR-2110	PAR-CLIP	23592263
MIRT469651	hsa-miR-6810-5p	PAR-CLIP	23592263
MIRT222456	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT222457	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT469650	hsa-miR-6857-5p	PAR-CLIP	23592263
MIRT222455	hsa-miR-450a-2-3p	PAR-CLIP	23592263
MIRT469649	hsa-miR-4260	PAR-CLIP	23592263
MIRT469647	hsa-miR-5572	PAR-CLIP	23592263
MIRT755702	mmu-miR-429-3p	Luciferase reporter assay	38767703
MIRT1286945	hsa-miR-1178	CLIP-seq
MIRT1286946	hsa-miR-1267	CLIP-seq
MIRT1286947	hsa-miR-1279	CLIP-seq
MIRT1286948	hsa-miR-1298	CLIP-seq
MIRT1286949	hsa-miR-137	CLIP-seq
MIRT1286950	hsa-miR-2276	CLIP-seq
MIRT1286951	hsa-miR-28-3p	CLIP-seq
MIRT1286952	hsa-miR-3065-3p	CLIP-seq
MIRT1286953	hsa-miR-31	CLIP-seq
MIRT1286954	hsa-miR-3121-5p	CLIP-seq
MIRT1286955	hsa-miR-3125	CLIP-seq
MIRT1286956	hsa-miR-3126-3p	CLIP-seq
MIRT1286957	hsa-miR-3128	CLIP-seq
MIRT1286958	hsa-miR-3173-3p	CLIP-seq
MIRT1286959	hsa-miR-329	CLIP-seq
MIRT1286960	hsa-miR-3613-5p	CLIP-seq
MIRT1286961	hsa-miR-362-3p	CLIP-seq
MIRT1286962	hsa-miR-365	CLIP-seq
MIRT1286963	hsa-miR-3653	CLIP-seq
MIRT1286964	hsa-miR-3658	CLIP-seq
MIRT1286965	hsa-miR-3677-5p	CLIP-seq
MIRT1286966	hsa-miR-3680	CLIP-seq
MIRT1286967	hsa-miR-3688-3p	CLIP-seq
MIRT1286968	hsa-miR-374a	CLIP-seq
MIRT1286969	hsa-miR-374b	CLIP-seq
MIRT1286970	hsa-miR-374c	CLIP-seq
MIRT1286971	hsa-miR-377	CLIP-seq
MIRT1286972	hsa-miR-381	CLIP-seq
MIRT1286973	hsa-miR-3916	CLIP-seq
MIRT1286974	hsa-miR-3934	CLIP-seq
MIRT1286975	hsa-miR-3978	CLIP-seq
MIRT1286976	hsa-miR-4299	CLIP-seq
MIRT1286977	hsa-miR-4427	CLIP-seq
MIRT1286978	hsa-miR-4521	CLIP-seq
MIRT1286979	hsa-miR-4645-3p	CLIP-seq
MIRT1286980	hsa-miR-4652-3p	CLIP-seq
MIRT1286981	hsa-miR-4680-3p	CLIP-seq
MIRT1286982	hsa-miR-4687-3p	CLIP-seq
MIRT1286983	hsa-miR-4695-5p	CLIP-seq
MIRT1286984	hsa-miR-4696	CLIP-seq
MIRT1286985	hsa-miR-4710	CLIP-seq
MIRT1286986	hsa-miR-4720-5p	CLIP-seq
MIRT1286987	hsa-miR-4772-3p	CLIP-seq
MIRT1286988	hsa-miR-4778-5p	CLIP-seq
MIRT1286989	hsa-miR-4792	CLIP-seq
MIRT1286990	hsa-miR-4799-3p	CLIP-seq
MIRT1286991	hsa-miR-4802-3p	CLIP-seq
MIRT1286992	hsa-miR-485-5p	CLIP-seq
MIRT1286993	hsa-miR-544	CLIP-seq
MIRT1286994	hsa-miR-548a-5p	CLIP-seq
MIRT1286995	hsa-miR-548ab	CLIP-seq
MIRT1286996	hsa-miR-548ak	CLIP-seq
MIRT1286997	hsa-miR-548b-5p	CLIP-seq
MIRT1286998	hsa-miR-548c-5p	CLIP-seq
MIRT1286999	hsa-miR-548d-5p	CLIP-seq
MIRT1287000	hsa-miR-548h	CLIP-seq
MIRT1287001	hsa-miR-548i	CLIP-seq
MIRT1287002	hsa-miR-548j	CLIP-seq
MIRT1287003	hsa-miR-548k	CLIP-seq
MIRT1287004	hsa-miR-548l	CLIP-seq
MIRT1287005	hsa-miR-548w	CLIP-seq
MIRT1287006	hsa-miR-548y	CLIP-seq
MIRT1287007	hsa-miR-559	CLIP-seq
MIRT1287008	hsa-miR-624	CLIP-seq
MIRT1287009	hsa-miR-655	CLIP-seq
MIRT1287010	hsa-miR-802	CLIP-seq
MIRT1287011	hsa-miR-877	CLIP-seq
MIRT1287012	hsa-miR-891b	CLIP-seq
MIRT1287013	hsa-miR-939	CLIP-seq
MIRT1287014	hsa-miR-941	CLIP-seq
MIRT1287015	hsa-miR-101	CLIP-seq
MIRT1286945	hsa-miR-1178	CLIP-seq
MIRT1287016	hsa-miR-1271	CLIP-seq
MIRT1286947	hsa-miR-1279	CLIP-seq
MIRT1287017	hsa-miR-129-5p	CLIP-seq
MIRT1287018	hsa-miR-1296	CLIP-seq
MIRT1286948	hsa-miR-1298	CLIP-seq
MIRT1287019	hsa-miR-136	CLIP-seq
MIRT1286949	hsa-miR-137	CLIP-seq
MIRT1287020	hsa-miR-144	CLIP-seq
MIRT1287021	hsa-miR-155	CLIP-seq
MIRT1287022	hsa-miR-182	CLIP-seq
MIRT1287023	hsa-miR-200b	CLIP-seq
MIRT1287024	hsa-miR-200c	CLIP-seq
MIRT1287025	hsa-miR-224	CLIP-seq
MIRT1287026	hsa-miR-2355-3p	CLIP-seq
MIRT1287027	hsa-miR-2909	CLIP-seq
MIRT1286952	hsa-miR-3065-3p	CLIP-seq
MIRT1286953	hsa-miR-31	CLIP-seq
MIRT1286954	hsa-miR-3121-5p	CLIP-seq
MIRT1287028	hsa-miR-3148	CLIP-seq
MIRT1287029	hsa-miR-3158-3p	CLIP-seq
MIRT1287030	hsa-miR-3160-3p	CLIP-seq
MIRT1286958	hsa-miR-3173-3p	CLIP-seq
MIRT1287031	hsa-miR-3174	CLIP-seq
MIRT1287032	hsa-miR-3179	CLIP-seq
MIRT1286959	hsa-miR-329	CLIP-seq
MIRT1287033	hsa-miR-3613-3p	CLIP-seq
MIRT1286960	hsa-miR-3613-5p	CLIP-seq
MIRT1286961	hsa-miR-362-3p	CLIP-seq
MIRT1286962	hsa-miR-365	CLIP-seq
MIRT1286963	hsa-miR-3653	CLIP-seq
MIRT1287034	hsa-miR-3657	CLIP-seq
MIRT1286964	hsa-miR-3658	CLIP-seq
MIRT1286965	hsa-miR-3677-5p	CLIP-seq
MIRT1286966	hsa-miR-3680	CLIP-seq
MIRT1286967	hsa-miR-3688-3p	CLIP-seq
MIRT1286968	hsa-miR-374a	CLIP-seq
MIRT1286969	hsa-miR-374b	CLIP-seq
MIRT1286970	hsa-miR-374c	CLIP-seq
MIRT1287035	hsa-miR-376a	CLIP-seq
MIRT1287036	hsa-miR-376b	CLIP-seq
MIRT1286971	hsa-miR-377	CLIP-seq
MIRT1286972	hsa-miR-381	CLIP-seq
MIRT1287037	hsa-miR-382	CLIP-seq
MIRT1287038	hsa-miR-4264	CLIP-seq
MIRT1287039	hsa-miR-429	CLIP-seq
MIRT1286976	hsa-miR-4299	CLIP-seq
MIRT1287040	hsa-miR-4424	CLIP-seq
MIRT1287041	hsa-miR-4446-3p	CLIP-seq
MIRT1287042	hsa-miR-4459	CLIP-seq
MIRT1287043	hsa-miR-4475	CLIP-seq
MIRT1287044	hsa-miR-4477a	CLIP-seq
MIRT1287045	hsa-miR-4487	CLIP-seq
MIRT1287046	hsa-miR-4539	CLIP-seq
MIRT1287047	hsa-miR-4646-3p	CLIP-seq
MIRT1287048	hsa-miR-4649-5p	CLIP-seq
MIRT1287049	hsa-miR-4663	CLIP-seq
MIRT1287050	hsa-miR-4669	CLIP-seq
MIRT1287051	hsa-miR-4678	CLIP-seq
MIRT1286982	hsa-miR-4687-3p	CLIP-seq
MIRT1286983	hsa-miR-4695-5p	CLIP-seq
MIRT1286984	hsa-miR-4696	CLIP-seq
MIRT1287052	hsa-miR-4698	CLIP-seq
MIRT1287053	hsa-miR-4700-3p	CLIP-seq
MIRT1286985	hsa-miR-4710	CLIP-seq
MIRT1287054	hsa-miR-4742-3p	CLIP-seq
MIRT1286989	hsa-miR-4792	CLIP-seq
MIRT1287055	hsa-miR-4803	CLIP-seq
MIRT1287056	hsa-miR-485-3p	CLIP-seq
MIRT1286992	hsa-miR-485-5p	CLIP-seq
MIRT1287057	hsa-miR-509-3p	CLIP-seq
MIRT1287058	hsa-miR-511	CLIP-seq
MIRT1287059	hsa-miR-513a-3p	CLIP-seq
MIRT1287060	hsa-miR-520d-5p	CLIP-seq
MIRT1287061	hsa-miR-522	CLIP-seq
MIRT1287062	hsa-miR-524-5p	CLIP-seq
MIRT1287063	hsa-miR-558	CLIP-seq
MIRT1287064	hsa-miR-590-3p	CLIP-seq
MIRT1287065	hsa-miR-616	CLIP-seq
MIRT1287008	hsa-miR-624	CLIP-seq
MIRT1287066	hsa-miR-630	CLIP-seq
MIRT1287067	hsa-miR-633	CLIP-seq
MIRT1287068	hsa-miR-640	CLIP-seq
MIRT1287009	hsa-miR-655	CLIP-seq
MIRT1287069	hsa-miR-659	CLIP-seq
MIRT1287070	hsa-miR-662	CLIP-seq
MIRT1287071	hsa-miR-676	CLIP-seq
MIRT1287013	hsa-miR-939	CLIP-seq
MIRT1287014	hsa-miR-941	CLIP-seq
MIRT1287072	hsa-miR-96	CLIP-seq
MIRT1286945	hsa-miR-1178	CLIP-seq
MIRT1286947	hsa-miR-1279	CLIP-seq
MIRT1286949	hsa-miR-137	CLIP-seq
MIRT1287038	hsa-miR-4264	CLIP-seq
MIRT1552884	hsa-miR-4704-3p	CLIP-seq
MIRT1286983	hsa-miR-4695-5p	CLIP-seq
MIRT1286945	hsa-miR-1178	CLIP-seq
MIRT1287017	hsa-miR-129-5p	CLIP-seq
MIRT1286948	hsa-miR-1298	CLIP-seq
MIRT1286949	hsa-miR-137	CLIP-seq
MIRT2085036	hsa-miR-146a	CLIP-seq
MIRT2085037	hsa-miR-146b-5p	CLIP-seq
MIRT1287023	hsa-miR-200b	CLIP-seq
MIRT1287024	hsa-miR-200c	CLIP-seq
MIRT1287026	hsa-miR-2355-3p	CLIP-seq
MIRT2085038	hsa-miR-3117-5p	CLIP-seq
MIRT1286954	hsa-miR-3121-5p	CLIP-seq
MIRT2085039	hsa-miR-3154	CLIP-seq
MIRT1287032	hsa-miR-3179	CLIP-seq
MIRT2085040	hsa-miR-3200-5p	CLIP-seq
MIRT2085041	hsa-miR-376c	CLIP-seq
MIRT1287037	hsa-miR-382	CLIP-seq
MIRT2085042	hsa-miR-3936	CLIP-seq
MIRT2085043	hsa-miR-4251	CLIP-seq
MIRT1287038	hsa-miR-4264	CLIP-seq
MIRT2085044	hsa-miR-4280	CLIP-seq
MIRT1287039	hsa-miR-429	CLIP-seq
MIRT2085045	hsa-miR-4329	CLIP-seq
MIRT2085046	hsa-miR-4436b-5p	CLIP-seq
MIRT1287047	hsa-miR-4646-3p	CLIP-seq
MIRT1287052	hsa-miR-4698	CLIP-seq
MIRT1552884	hsa-miR-4704-3p	CLIP-seq
MIRT2085047	hsa-miR-502-5p	CLIP-seq
MIRT1287058	hsa-miR-511	CLIP-seq
MIRT2085048	hsa-miR-589	CLIP-seq
MIRT1287071	hsa-miR-676	CLIP-seq
MIRT2085049	hsa-miR-1256	CLIP-seq
MIRT2085050	hsa-miR-302f	CLIP-seq
MIRT2085041	hsa-miR-376c	CLIP-seq
MIRT2085051	hsa-miR-4642	CLIP-seq
MIRT2085052	hsa-miR-493	CLIP-seq
MIRT1287068	hsa-miR-640	CLIP-seq
MIRT1287015	hsa-miR-101	CLIP-seq
MIRT1286945	hsa-miR-1178	CLIP-seq
MIRT2310496	hsa-miR-1200	CLIP-seq
MIRT2085049	hsa-miR-1256	CLIP-seq
MIRT1286946	hsa-miR-1267	CLIP-seq
MIRT1287016	hsa-miR-1271	CLIP-seq
MIRT1286947	hsa-miR-1279	CLIP-seq
MIRT1286948	hsa-miR-1298	CLIP-seq
MIRT2310497	hsa-miR-1303	CLIP-seq
MIRT1287019	hsa-miR-136	CLIP-seq
MIRT1286949	hsa-miR-137	CLIP-seq
MIRT1287020	hsa-miR-144	CLIP-seq
MIRT2085036	hsa-miR-146a	CLIP-seq
MIRT2085037	hsa-miR-146b-5p	CLIP-seq
MIRT1287022	hsa-miR-182	CLIP-seq
MIRT1287023	hsa-miR-200b	CLIP-seq
MIRT1287024	hsa-miR-200c	CLIP-seq
MIRT2310498	hsa-miR-217	CLIP-seq
MIRT1287025	hsa-miR-224	CLIP-seq
MIRT1287026	hsa-miR-2355-3p	CLIP-seq
MIRT1286951	hsa-miR-28-3p	CLIP-seq
MIRT2085050	hsa-miR-302f	CLIP-seq
MIRT1286952	hsa-miR-3065-3p	CLIP-seq
MIRT2310499	hsa-miR-3074-5p	CLIP-seq
MIRT2085038	hsa-miR-3117-5p	CLIP-seq
MIRT1286954	hsa-miR-3121-5p	CLIP-seq
MIRT1286955	hsa-miR-3125	CLIP-seq
MIRT1286956	hsa-miR-3126-3p	CLIP-seq
MIRT2310500	hsa-miR-3130-3p	CLIP-seq
MIRT2085039	hsa-miR-3154	CLIP-seq
MIRT1286958	hsa-miR-3173-3p	CLIP-seq
MIRT1287031	hsa-miR-3174	CLIP-seq
MIRT1287032	hsa-miR-3179	CLIP-seq
MIRT2310501	hsa-miR-3184	CLIP-seq
MIRT2085040	hsa-miR-3200-5p	CLIP-seq
MIRT2310502	hsa-miR-320b	CLIP-seq
MIRT2310503	hsa-miR-320c	CLIP-seq
MIRT2310504	hsa-miR-320d	CLIP-seq
MIRT2310505	hsa-miR-320e	CLIP-seq
MIRT1286959	hsa-miR-329	CLIP-seq
MIRT2310506	hsa-miR-33a	CLIP-seq
MIRT2310507	hsa-miR-33b	CLIP-seq
MIRT2310508	hsa-miR-346	CLIP-seq
MIRT1287033	hsa-miR-3613-3p	CLIP-seq
MIRT1286960	hsa-miR-3613-5p	CLIP-seq
MIRT1286961	hsa-miR-362-3p	CLIP-seq
MIRT1286962	hsa-miR-365	CLIP-seq
MIRT1286965	hsa-miR-3677-5p	CLIP-seq
MIRT1286967	hsa-miR-3688-3p	CLIP-seq
MIRT1286968	hsa-miR-374a	CLIP-seq
MIRT1286969	hsa-miR-374b	CLIP-seq
MIRT1286970	hsa-miR-374c	CLIP-seq
MIRT2085041	hsa-miR-376c	CLIP-seq
MIRT1286971	hsa-miR-377	CLIP-seq
MIRT1286972	hsa-miR-381	CLIP-seq
MIRT1287037	hsa-miR-382	CLIP-seq
MIRT1286973	hsa-miR-3916	CLIP-seq
MIRT1286974	hsa-miR-3934	CLIP-seq
MIRT2085042	hsa-miR-3936	CLIP-seq
MIRT1286975	hsa-miR-3978	CLIP-seq
MIRT2310509	hsa-miR-423-5p	CLIP-seq
MIRT2085043	hsa-miR-4251	CLIP-seq
MIRT1287038	hsa-miR-4264	CLIP-seq
MIRT2310510	hsa-miR-4274	CLIP-seq
MIRT2310511	hsa-miR-4277	CLIP-seq
MIRT2085044	hsa-miR-4280	CLIP-seq
MIRT2310512	hsa-miR-4288	CLIP-seq
MIRT1287039	hsa-miR-429	CLIP-seq
MIRT2085045	hsa-miR-4329	CLIP-seq
MIRT2310513	hsa-miR-4418	CLIP-seq
MIRT1287040	hsa-miR-4424	CLIP-seq
MIRT1286977	hsa-miR-4427	CLIP-seq
MIRT2310514	hsa-miR-4429	CLIP-seq
MIRT2085046	hsa-miR-4436b-5p	CLIP-seq
MIRT1287043	hsa-miR-4475	CLIP-seq
MIRT1287044	hsa-miR-4477a	CLIP-seq
MIRT2310515	hsa-miR-4495	CLIP-seq
MIRT2310516	hsa-miR-4499	CLIP-seq
MIRT2310517	hsa-miR-4519	CLIP-seq
MIRT1286978	hsa-miR-4521	CLIP-seq
MIRT1287046	hsa-miR-4539	CLIP-seq
MIRT2085051	hsa-miR-4642	CLIP-seq
MIRT1286979	hsa-miR-4645-3p	CLIP-seq
MIRT1287047	hsa-miR-4646-3p	CLIP-seq
MIRT1287048	hsa-miR-4649-5p	CLIP-seq
MIRT1286980	hsa-miR-4652-3p	CLIP-seq
MIRT2310518	hsa-miR-4656	CLIP-seq
MIRT2310519	hsa-miR-4658	CLIP-seq
MIRT2310520	hsa-miR-4670-5p	CLIP-seq
MIRT1287051	hsa-miR-4678	CLIP-seq
MIRT1286981	hsa-miR-4680-3p	CLIP-seq
MIRT2310521	hsa-miR-4680-5p	CLIP-seq
MIRT1286982	hsa-miR-4687-3p	CLIP-seq
MIRT1286983	hsa-miR-4695-5p	CLIP-seq
MIRT1287052	hsa-miR-4698	CLIP-seq
MIRT1287053	hsa-miR-4700-3p	CLIP-seq
MIRT1552884	hsa-miR-4704-3p	CLIP-seq
MIRT2310522	hsa-miR-4715-5p	CLIP-seq
MIRT2310523	hsa-miR-4719	CLIP-seq
MIRT1287054	hsa-miR-4742-3p	CLIP-seq
MIRT2310524	hsa-miR-4758-5p	CLIP-seq
MIRT1286988	hsa-miR-4778-5p	CLIP-seq
MIRT2310525	hsa-miR-4793-3p	CLIP-seq
MIRT1286991	hsa-miR-4802-3p	CLIP-seq
MIRT1287055	hsa-miR-4803	CLIP-seq
MIRT1287056	hsa-miR-485-3p	CLIP-seq
MIRT1286992	hsa-miR-485-5p	CLIP-seq
MIRT2085047	hsa-miR-502-5p	CLIP-seq
MIRT2310526	hsa-miR-509-3-5p	CLIP-seq
MIRT2310527	hsa-miR-509-5p	CLIP-seq
MIRT1287058	hsa-miR-511	CLIP-seq
MIRT1287060	hsa-miR-520d-5p	CLIP-seq
MIRT1287062	hsa-miR-524-5p	CLIP-seq
MIRT1286994	hsa-miR-548a-5p	CLIP-seq
MIRT1286995	hsa-miR-548ab	CLIP-seq
MIRT2310528	hsa-miR-548ac	CLIP-seq
MIRT2310529	hsa-miR-548ae	CLIP-seq
MIRT2310530	hsa-miR-548aj	CLIP-seq
MIRT1286996	hsa-miR-548ak	CLIP-seq
MIRT2310531	hsa-miR-548am	CLIP-seq
MIRT1286997	hsa-miR-548b-5p	CLIP-seq
MIRT1286998	hsa-miR-548c-5p	CLIP-seq
MIRT2310532	hsa-miR-548d-3p	CLIP-seq
MIRT1286999	hsa-miR-548d-5p	CLIP-seq
MIRT1287000	hsa-miR-548h	CLIP-seq
MIRT1287001	hsa-miR-548i	CLIP-seq
MIRT1287002	hsa-miR-548j	CLIP-seq
MIRT1287003	hsa-miR-548k	CLIP-seq
MIRT1287004	hsa-miR-548l	CLIP-seq
MIRT2310533	hsa-miR-548u	CLIP-seq
MIRT1287005	hsa-miR-548w	CLIP-seq
MIRT2310534	hsa-miR-548x	CLIP-seq
MIRT1287006	hsa-miR-548y	CLIP-seq
MIRT2310535	hsa-miR-548z	CLIP-seq
MIRT1287007	hsa-miR-559	CLIP-seq
MIRT2085048	hsa-miR-589	CLIP-seq
MIRT1287008	hsa-miR-624	CLIP-seq
MIRT2310536	hsa-miR-627	CLIP-seq
MIRT1287066	hsa-miR-630	CLIP-seq
MIRT2310537	hsa-miR-632	CLIP-seq
MIRT1287067	hsa-miR-633	CLIP-seq
MIRT1287068	hsa-miR-640	CLIP-seq
MIRT1287009	hsa-miR-655	CLIP-seq
MIRT1287070	hsa-miR-662	CLIP-seq
MIRT1287071	hsa-miR-676	CLIP-seq
MIRT1287010	hsa-miR-802	CLIP-seq
MIRT1287011	hsa-miR-877	CLIP-seq
MIRT2310538	hsa-miR-924	CLIP-seq
MIRT1287013	hsa-miR-939	CLIP-seq
MIRT1287014	hsa-miR-941	CLIP-seq
MIRT1287072	hsa-miR-96	CLIP-seq
MIRT1286948	hsa-miR-1298	CLIP-seq
MIRT1287034	hsa-miR-3657	CLIP-seq
MIRT1286966	hsa-miR-3680	CLIP-seq
MIRT1286976	hsa-miR-4299	CLIP-seq
MIRT1287042	hsa-miR-4459	CLIP-seq
MIRT1287043	hsa-miR-4475	CLIP-seq
MIRT1287048	hsa-miR-4649-5p	CLIP-seq
MIRT1287050	hsa-miR-4669	CLIP-seq
MIRT1286982	hsa-miR-4687-3p	CLIP-seq
MIRT1286983	hsa-miR-4695-5p	CLIP-seq
MIRT1287053	hsa-miR-4700-3p	CLIP-seq
MIRT1286985	hsa-miR-4710	CLIP-seq
MIRT1286989	hsa-miR-4792	CLIP-seq
MIRT1286992	hsa-miR-485-5p	CLIP-seq
MIRT1287060	hsa-miR-520d-5p	CLIP-seq
MIRT1287062	hsa-miR-524-5p	CLIP-seq
MIRT2310528	hsa-miR-548ac	CLIP-seq
MIRT2310532	hsa-miR-548d-3p	CLIP-seq
MIRT2310535	hsa-miR-548z	CLIP-seq
MIRT1287034	hsa-miR-3657	CLIP-seq
MIRT1287042	hsa-miR-4459	CLIP-seq
MIRT1287050	hsa-miR-4669	CLIP-seq
MIRT1286983	hsa-miR-4695-5p	CLIP-seq
MIRT1287053	hsa-miR-4700-3p	CLIP-seq
MIRT1287015	hsa-miR-101	CLIP-seq
MIRT2310496	hsa-miR-1200	CLIP-seq
MIRT1286946	hsa-miR-1267	CLIP-seq
MIRT1286948	hsa-miR-1298	CLIP-seq
MIRT1287019	hsa-miR-136	CLIP-seq
MIRT1287020	hsa-miR-144	CLIP-seq
MIRT2085036	hsa-miR-146a	CLIP-seq
MIRT2085037	hsa-miR-146b-5p	CLIP-seq
MIRT1287023	hsa-miR-200b	CLIP-seq
MIRT1287024	hsa-miR-200c	CLIP-seq
MIRT2310498	hsa-miR-217	CLIP-seq
MIRT1287026	hsa-miR-2355-3p	CLIP-seq
MIRT2310499	hsa-miR-3074-5p	CLIP-seq
MIRT2085038	hsa-miR-3117-5p	CLIP-seq
MIRT1286954	hsa-miR-3121-5p	CLIP-seq
MIRT1286955	hsa-miR-3125	CLIP-seq
MIRT1287030	hsa-miR-3160-3p	CLIP-seq
MIRT2085040	hsa-miR-3200-5p	CLIP-seq
MIRT1286959	hsa-miR-329	CLIP-seq
MIRT1286960	hsa-miR-3613-5p	CLIP-seq
MIRT1286961	hsa-miR-362-3p	CLIP-seq
MIRT1286962	hsa-miR-365	CLIP-seq
MIRT1286963	hsa-miR-3653	CLIP-seq
MIRT1287034	hsa-miR-3657	CLIP-seq
MIRT1286964	hsa-miR-3658	CLIP-seq
MIRT1286965	hsa-miR-3677-5p	CLIP-seq
MIRT1286966	hsa-miR-3680	CLIP-seq
MIRT2085041	hsa-miR-376c	CLIP-seq
MIRT1286971	hsa-miR-377	CLIP-seq
MIRT1286973	hsa-miR-3916	CLIP-seq
MIRT1286974	hsa-miR-3934	CLIP-seq
MIRT2085043	hsa-miR-4251	CLIP-seq
MIRT2310510	hsa-miR-4274	CLIP-seq
MIRT2310511	hsa-miR-4277	CLIP-seq
MIRT2085044	hsa-miR-4280	CLIP-seq
MIRT1287039	hsa-miR-429	CLIP-seq
MIRT1286976	hsa-miR-4299	CLIP-seq
MIRT2085045	hsa-miR-4329	CLIP-seq
MIRT2310513	hsa-miR-4418	CLIP-seq
MIRT2085046	hsa-miR-4436b-5p	CLIP-seq
MIRT1287042	hsa-miR-4459	CLIP-seq
MIRT1287045	hsa-miR-4487	CLIP-seq
MIRT2310517	hsa-miR-4519	CLIP-seq
MIRT1287047	hsa-miR-4646-3p	CLIP-seq
MIRT1287048	hsa-miR-4649-5p	CLIP-seq
MIRT1286980	hsa-miR-4652-3p	CLIP-seq
MIRT1287049	hsa-miR-4663	CLIP-seq
MIRT1287050	hsa-miR-4669	CLIP-seq
MIRT1286982	hsa-miR-4687-3p	CLIP-seq
MIRT1286983	hsa-miR-4695-5p	CLIP-seq
MIRT1287052	hsa-miR-4698	CLIP-seq
MIRT1287053	hsa-miR-4700-3p	CLIP-seq
MIRT1286985	hsa-miR-4710	CLIP-seq
MIRT1286988	hsa-miR-4778-5p	CLIP-seq
MIRT1286989	hsa-miR-4792	CLIP-seq
MIRT1286992	hsa-miR-485-5p	CLIP-seq
MIRT2085047	hsa-miR-502-5p	CLIP-seq
MIRT2310526	hsa-miR-509-3-5p	CLIP-seq
MIRT2310527	hsa-miR-509-5p	CLIP-seq
MIRT1287058	hsa-miR-511	CLIP-seq
MIRT2606936	hsa-miR-514	CLIP-seq
MIRT2606937	hsa-miR-514b-3p	CLIP-seq
MIRT1287063	hsa-miR-558	CLIP-seq
MIRT2606938	hsa-miR-570	CLIP-seq
MIRT2085048	hsa-miR-589	CLIP-seq
MIRT1287068	hsa-miR-640	CLIP-seq
MIRT1287071	hsa-miR-676	CLIP-seq
MIRT1287011	hsa-miR-877	CLIP-seq
MIRT1287013	hsa-miR-939	CLIP-seq
MIRT1287014	hsa-miR-941	CLIP-seq
MIRT1287015	hsa-miR-101	CLIP-seq
MIRT2310496	hsa-miR-1200	CLIP-seq
MIRT1286948	hsa-miR-1298	CLIP-seq
MIRT1287019	hsa-miR-136	CLIP-seq
MIRT1287020	hsa-miR-144	CLIP-seq
MIRT2085036	hsa-miR-146a	CLIP-seq
MIRT2085037	hsa-miR-146b-5p	CLIP-seq
MIRT1287023	hsa-miR-200b	CLIP-seq
MIRT1287024	hsa-miR-200c	CLIP-seq
MIRT2310498	hsa-miR-217	CLIP-seq
MIRT1287026	hsa-miR-2355-3p	CLIP-seq
MIRT2310499	hsa-miR-3074-5p	CLIP-seq
MIRT2085038	hsa-miR-3117-5p	CLIP-seq
MIRT1286954	hsa-miR-3121-5p	CLIP-seq
MIRT1286955	hsa-miR-3125	CLIP-seq
MIRT1287030	hsa-miR-3160-3p	CLIP-seq
MIRT2085040	hsa-miR-3200-5p	CLIP-seq
MIRT1286959	hsa-miR-329	CLIP-seq
MIRT1286961	hsa-miR-362-3p	CLIP-seq
MIRT1286962	hsa-miR-365	CLIP-seq
MIRT1286963	hsa-miR-3653	CLIP-seq
MIRT1287034	hsa-miR-3657	CLIP-seq
MIRT1286964	hsa-miR-3658	CLIP-seq
MIRT1286966	hsa-miR-3680	CLIP-seq
MIRT2085041	hsa-miR-376c	CLIP-seq
MIRT1286971	hsa-miR-377	CLIP-seq
MIRT1286973	hsa-miR-3916	CLIP-seq
MIRT1286974	hsa-miR-3934	CLIP-seq
MIRT2085043	hsa-miR-4251	CLIP-seq
MIRT2310510	hsa-miR-4274	CLIP-seq
MIRT2310511	hsa-miR-4277	CLIP-seq
MIRT2085044	hsa-miR-4280	CLIP-seq
MIRT1287039	hsa-miR-429	CLIP-seq
MIRT1286976	hsa-miR-4299	CLIP-seq
MIRT2085045	hsa-miR-4329	CLIP-seq
MIRT2310513	hsa-miR-4418	CLIP-seq
MIRT2085046	hsa-miR-4436b-5p	CLIP-seq
MIRT1287042	hsa-miR-4459	CLIP-seq
MIRT1287045	hsa-miR-4487	CLIP-seq
MIRT2310517	hsa-miR-4519	CLIP-seq
MIRT1287047	hsa-miR-4646-3p	CLIP-seq
MIRT1287048	hsa-miR-4649-5p	CLIP-seq
MIRT1286980	hsa-miR-4652-3p	CLIP-seq
MIRT1287049	hsa-miR-4663	CLIP-seq
MIRT1287050	hsa-miR-4669	CLIP-seq
MIRT1286982	hsa-miR-4687-3p	CLIP-seq
MIRT1286983	hsa-miR-4695-5p	CLIP-seq
MIRT1287052	hsa-miR-4698	CLIP-seq
MIRT1287053	hsa-miR-4700-3p	CLIP-seq
MIRT1286985	hsa-miR-4710	CLIP-seq
MIRT1286989	hsa-miR-4792	CLIP-seq
MIRT1286992	hsa-miR-485-5p	CLIP-seq
MIRT2085047	hsa-miR-502-5p	CLIP-seq
MIRT2310526	hsa-miR-509-3-5p	CLIP-seq
MIRT2310527	hsa-miR-509-5p	CLIP-seq
MIRT1287058	hsa-miR-511	CLIP-seq
MIRT2606936	hsa-miR-514	CLIP-seq
MIRT2606937	hsa-miR-514b-3p	CLIP-seq
MIRT1287063	hsa-miR-558	CLIP-seq
MIRT2606938	hsa-miR-570	CLIP-seq
MIRT2085048	hsa-miR-589	CLIP-seq
MIRT1287068	hsa-miR-640	CLIP-seq
MIRT1287071	hsa-miR-676	CLIP-seq
MIRT1287011	hsa-miR-877	CLIP-seq
MIRT1287013	hsa-miR-939	CLIP-seq
MIRT1287014	hsa-miR-941	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
PTTG1	Activation	22081074

186

Show/Hide all (186)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000242	Component	Pericentriolar material	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001764	Process	Neuron migration	ISS
GO:0001891	Component	Phagocytic cup	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	23633677
GO:0002093	Process	Auditory receptor cell morphogenesis	IEA
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IMP	18558630
GO:0003382	Process	Epithelial cell morphogenesis	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	19787194, 27917469
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	2674130, 9312003
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	7673236, 8625410, 8670882, 9312003, 10051605, 11030651, 11260256, 11346801, 11513578, 11696321, 11807099, 12134158, 12874273, 12879077, 12915445, 12919680, 15048733, 15247908, 15723800, 16492808, 16628218, 16636067, 16968699, 17003044, 17145773, 17245428, 18511940, 18809683, 1917175
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	12551911, 15467718, 15601624, 22036506, 23620790
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	IMP	19625648
GO:0005634	Component	Nucleus	IDA	12551911
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	19625648
GO:0005737	Component	Cytoplasm	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005802	Component	Trans-Golgi network	IDA	12915445
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005884	Component	Actin filament	IDA	19625648
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10036235
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	27048830
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005938	Component	Cell cortex	IDA	19126672
GO:0006897	Process	Endocytosis	IEA
GO:0006911	Process	Phagocytosis, engulfment	IEA
GO:0006954	Process	Inflammatory response	IC	9572733
GO:0006954	Process	Inflammatory response	TAS	9572733
GO:0006972	Process	Hyperosmotic response	IEA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007015	Process	Actin filament organization	IBA
GO:0007015	Process	Actin filament organization	IMP	22796473
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	9572733
GO:0007160	Process	Cell-matrix adhesion	NAS	18156211
GO:0007163	Process	Establishment or maintenance of cell polarity	IBA
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IMP	26934001
GO:0007411	Process	Axon guidance	IEA
GO:0008045	Process	Motor neuron axon guidance	IBA
GO:0008360	Process	Regulation of cell shape	IBA
GO:0009611	Process	Response to wounding	TAS	9572733
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9572733
GO:0010310	Process	Regulation of hydrogen peroxide metabolic process	TAS	16636067
GO:0010591	Process	Regulation of lamellipodium assembly	IGI	8625410
GO:0010592	Process	Positive regulation of lamellipodium assembly	IDA	15467718
GO:0010592	Process	Positive regulation of lamellipodium assembly	IMP	8625410, 19625648
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	18558630
GO:0010762	Process	Regulation of fibroblast migration	IEA
GO:0010764	Process	Negative regulation of fibroblast migration	IDA	19126672
GO:0010810	Process	Regulation of cell-substrate adhesion	IEA
GO:0010811	Process	Positive regulation of cell-substrate adhesion	IGI	20926685
GO:0014041	Process	Regulation of neuron maturation	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016358	Process	Dendrite development	IEA
GO:0016477	Process	Cell migration	IDA	23512198
GO:0016477	Process	Cell migration	IEA
GO:0016477	Process	Cell migration	IMP	26934001
GO:0016601	Process	Rac protein signal transduction	IBA
GO:0016601	Process	Rac protein signal transduction	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019899	Function	Enzyme binding	IPI	16636067
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IPI	8625410
GO:0021799	Process	Cerebral cortex radially oriented cell migration	IEA
GO:0021831	Process	Embryonic olfactory bulb interneuron precursor migration	IEA
GO:0021894	Process	Cerebral cortex GABAergic interneuron development	IEA
GO:0022604	Process	Regulation of cell morphogenesis	IEA
GO:0030027	Component	Lamellipodium	IDA	19126672, 19625648
GO:0030027	Component	Lamellipodium	IEA
GO:0030031	Process	Cell projection assembly	IBA
GO:0030032	Process	Lamellipodium assembly	IEA
GO:0030032	Process	Lamellipodium assembly	IMP	9312003
GO:0030036	Process	Actin cytoskeleton organization	IGI	19890013
GO:0030041	Process	Actin filament polymerization	IEA
GO:0030041	Process	Actin filament polymerization	TAS	9312003
GO:0030334	Process	Regulation of cell migration	IMP	19934221, 22036506
GO:0030425	Component	Dendrite	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030742	Function	GTP-dependent protein binding	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	IEA
GO:0030865	Process	Cortical cytoskeleton organization	IBA
GO:0030900	Process	Forebrain development	IEA
GO:0031116	Process	Positive regulation of microtubule polymerization	IMP	25198505
GO:0031410	Component	Cytoplasmic vesicle	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031529	Process	Ruffle organization	TAS	9312003
GO:0031901	Component	Early endosome membrane	IEA
GO:0031996	Function	Thioesterase binding	IPI	12612085
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032587	Component	Ruffle membrane	IDA	20875796
GO:0032587	Component	Ruffle membrane	IEA
GO:0032707	Process	Negative regulation of interleukin-23 production	IDA	16982892
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IMP	19625648, 28886345
GO:0035025	Process	Positive regulation of Rho protein signal transduction	TAS	9312003
GO:0035556	Process	Intracellular signal transduction	TAS	9572733
GO:0035567	Process	Non-canonical Wnt signaling pathway	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0042470	Component	Melanosome	IEA
GO:0042554	Process	Superoxide anion generation	IDA	38355798
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043020	Component	NADPH oxidase complex	IDA	38355798
GO:0043020	Component	NADPH oxidase complex	NAS	24598074
GO:0043131	Process	Erythrocyte enucleation	IEA
GO:0043652	Process	Engulfment of apoptotic cell	IEA
GO:0044877	Function	Protein-containing complex binding	IDA	21107423
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045216	Process	Cell-cell junction organization	IEA
GO:0045428	Process	Regulation of nitric oxide biosynthetic process	ISS
GO:0045730	Process	Respiratory burst	NAS	27048830
GO:0046425	Process	Regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0048012	Process	Hepatocyte growth factor receptor signaling pathway	IMP	25198505
GO:0048168	Process	Regulation of neuronal synaptic plasticity	IEA
GO:0048261	Process	Negative regulation of receptor-mediated endocytosis	TAS	9312003
GO:0048532	Process	Anatomical structure arrangement	IEA
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0048813	Process	Dendrite morphogenesis	IEA
GO:0048870	Process	Cell motility	IDA	19403692
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0051022	Function	Rho GDP-dissociation inhibitor binding	ISS
GO:0051492	Process	Regulation of stress fiber assembly	IGI	8625410
GO:0051496	Process	Positive regulation of stress fiber assembly	IDA	23129259
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	8625410
GO:0051668	Process	Localization within membrane	IMP	16636067
GO:0051894	Process	Positive regulation of focal adhesion assembly	IDA	23129259
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051932	Process	Synaptic transmission, GABAergic	IEA
GO:0055038	Component	Recycling endosome membrane	IDA	10036235
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	IEA
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	NAS	24431302
GO:0060091	Component	Kinocilium	IEA
GO:0060263	Process	Regulation of respiratory burst	IDA	16636067
GO:0060326	Process	Cell chemotaxis	IBA
GO:0060999	Process	Positive regulation of dendritic spine development	IEA
GO:0061344	Process	Regulation of cell adhesion involved in heart morphogenesis	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:0070376	Process	Regulation of ERK5 cascade	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	ISS
GO:0071542	Process	Dopaminergic neuron differentiation	IEA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0086098	Process	Angiotensin-activated signaling pathway involved in heart process	IEA
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IMP	19625648
GO:0090103	Process	Cochlea morphogenesis	IEA
GO:0097178	Process	Ruffle assembly	IEA
GO:0097178	Process	Ruffle assembly	IMP	10036235
GO:0098794	Component	Postsynapse	IDA	15800193, 24352656
GO:0098794	Component	Postsynapse	IMP	15800193, 24352656
GO:0098978	Component	Glutamatergic synapse	IDA	15800193, 24352656
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IMP	15800193, 24352656
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:0150052	Process	Regulation of postsynapse assembly	IEA
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IDA	23129259
GO:1900029	Process	Positive regulation of ruffle assembly	IDA	15467718
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IEA
GO:1902622	Process	Regulation of neutrophil migration	IBA
GO:1903348	Process	Positive regulation of bicellular tight junction assembly	IMP	22796473
GO:1904395	Process	Positive regulation of skeletal muscle acetylcholine-gated channel clustering	IEA
GO:1904936	Process	Interneuron migration	IEA
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	IEA
GO:2000386	Process	Positive regulation of ovarian follicle development	IEA
GO:2001222	Process	Regulation of neuron migration	IEA

MIM	HGNC	e!Ensembl
602048	9801	ENSG00000136238

P63000

Protein name

Ras-related C3 botulinum toxin substrate 1 (EC 3.6.5.2) (Cell migration-inducing gene 5 protein) (Ras-like protein TC25) (p21-Rac1)

Protein function

Plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of

PDB

1E96 , 1FOE , 1G4U , 1HE1 , 1HH4 , 1I4D , 1I4L , 1I4T , 1MH1 , 1RYF , 1RYH , 2FJU , 2H7V , 2NZ8 , 2P2L , 2RMK , 2VRW , 2WKP , 2WKQ , 2WKR , 2YIN , 3B13 , 3BJI , 3RYT , 3SBD , 3SBE , 3SU8 , 3SUA , 3TH5 , 4GZL , 4GZM , 4YON , 5FI0 , 5HZH , 5N6O , 5O33 , 5QQD , 5QQE , 5QQF , 5QQG , 5QQH , 5QQI , 5QQJ , 5QQK , 5QQL , 5QQM , 5QQN , 5QU9 , 6AGP , 6BC1 , 6TGC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	5 → 178	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform B is predominantly identified in skin and epithelial tissues from the intestinal tract. Its expression is elevated in colorectal tumors at various stages of neoplastic progression, as compared to their respective adjacent tissu

Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL

Sequence length

192

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway cAMP signaling pathway Chemokine signaling pathway Sphingolipid signaling pathway Phagosome Efferocytosis PI3K-Akt signaling pathway Wnt signaling pathway Axon guidance VEGF signaling pathway Osteoclast differentiation Focal adhesion Adherens junction Tight junction Neutrophil extracellular trap formation Toll-like receptor signaling pathway Natural killer cell mediated cytotoxicity B cell receptor signaling pathway Fc epsilon RI signaling pathway Fc gamma R-mediated phagocytosis Leukocyte transendothelial migration Neurotrophin signaling pathway Regulation of actin cytoskeleton Non-alcoholic fatty liver disease AGE-RAGE signaling pathway in diabetic complications Pancreatic secretion Amyotrophic lateral sclerosis Prion disease Pathways of neurodegeneration - multiple diseases Bacterial invasion of epithelial cells Epithelial cell signaling in Helicobacter pylori infection Pathogenic Escherichia coli infection Shigellosis Salmonella infection Yersinia infection Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Pathways in cancer Viral carcinogenesis Proteoglycans in cancer Chemical carcinogenesis - reactive oxygen species Colorectal cancer Renal cell carcinoma Pancreatic cancer Choline metabolism in cancer Diabetic cardiomyopathy Viral myocarditis Lipid and atherosclerosis Fluid shear stress and atherosclerosis		GPVI-mediated activation cascade PIP3 activates AKT signaling Signaling by SCF-KIT Nef and signal transduction NRAGE signals death through JNK Rho GTPase cycle Regulation of actin dynamics for phagocytic cup formation Constitutive Signaling by Aberrant PI3K in Cancer DAP12 signaling FCERI mediated MAPK activation DSCAM interactions CD28 dependent Vav1 pathway EPHB-mediated forward signaling Ephrin signaling EPH-ephrin mediated repulsion of cells Sema3A PAK dependent Axon repulsion PCP/CE pathway Sema4D mediated inhibition of cell attachment and migration DCC mediated attractive signaling VEGFA-VEGFR2 Pathway Signal transduction by L1 VEGFR2 mediated vascular permeability RHO GTPases activate PKNs RHO GTPases activate CIT RHO GTPases activate KTN1 RHO GTPases activate IQGAPs RHO GTPases activate PAKs RHO GTPases Activate WASPs and WAVEs RHO GTPases Activate Formins RHO GTPases Activate NADPH Oxidases MAPK6/MAPK4 signaling Neutrophil degranulation PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases MET activates RAP1 and RAC1 NTRK2 activates RAC1 FCGR3A-mediated phagocytosis WNT5:FZD7-mediated leishmania damping Factors involved in megakaryocyte development and platelet production

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Global developmental delay	Likely pathogenic; Pathogenic	rs1554263624	RCV001255401
Intellectual disability, autosomal dominant 48	Likely pathogenic; Pathogenic	rs1783105049, rs2115201441, rs2115201389, rs2115201430, rs2115218399, rs2534029571, rs1554263626, rs2534029561, rs2115201406, rs964265383, rs1554263326, rs1554263624, rs1554264268, rs1554263625	RCV001328553 RCV002246381 RCV001808906 RCV002249146 RCV003228808 RCV003228809 RCV003142505 RCV003156716 RCV003156718 RCV003156719 RCV004555018 RCV000513864 RCV000514438 RCV000515033 RCV000514176 RCV000514583 RCV000515028
Neurodevelopmental delay	Likely pathogenic; Pathogenic	rs1554263624	RCV002274050
Neurodevelopmental disorder with dysmorphic facies and distal limb anomalies	Likely pathogenic	rs1554263625	RCV003150251
See cases	Likely pathogenic; Pathogenic	rs2115201441	RCV001420220

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Developmental disorder	Likely benign	rs2115214243	RCV001843734
Neoplasm	-	rs1057519948	RCV006273285
RAC1-related disorder	Likely benign; Uncertain significance; Benign	rs140589960, rs2534029675, rs2115218459, rs148122613, rs139010955	RCV004754973 RCV003402585 RCV003909259 RCV003931729 RCV003950829

Show/Hide Text Mining Associations (176)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Multiple	Associate	37328543
Adams Oliver syndrome	Associate	27693507, 36059114
Adenocarcinoma	Associate	23525077, 25371063
Adenocarcinoma of Lung	Associate	17709373, 31811797, 34731623, 37311571
Adenocarcinoma of Lung	Stimulate	33134373
Adenoma	Associate	12865273
Adenomatous Polyposis Coli	Associate	12865273, 17145773, 34986841
Alzheimer Disease	Associate	22142809, 23223568
Alzheimer Disease	Stimulate	25676811
Amyotrophic Lateral Sclerosis 2 Juvenile	Associate	30224357
Anemia Diamond Blackfan	Associate	29745857
Anophthalmos with limb anomalies	Associate	21565291
Arthritis	Associate	25289457
Arthritis Rheumatoid	Associate	27498552
Astrocytoma	Associate	16204049, 16527811, 22151302, 26897750
Bacterial Infections	Associate	22451524
Barrett Esophagus	Associate	21525435
Bipolar Disorder	Stimulate	25956630
Blood Platelet Disorders	Associate	21134286, 34546355
Brain Diseases	Associate	36054930
Breast Diseases	Associate	10871853
Breast Neoplasms	Associate	10871853, 12377770, 16280046, 20110378, 20507565, 21118977, 21172654, 21980400, 22494620, 22689141, 23591873, 23762409, 23975422, 24434436, 25273174 View all (24 more)
Breast Neoplasms	Inhibit	39527598
Calcinosis Cutis	Associate	16280046, 18086571, 23345605
Carcinogenesis	Associate	12865273, 18246045, 20426825, 22179719, 23525077, 26860615, 27100492, 27699663, 28947497, 30891502, 32275841, 36443711, 38243078
Carcinoma Basal Cell	Associate	23435205
Carcinoma Ductal Breast	Associate	28671041
Carcinoma Hepatocellular	Associate	12896980, 15777850, 21482222, 22701712, 25428919, 25472720, 26933917, 30182377, 30191377, 36675278, 37540188, 38041179
Carcinoma Non Small Cell Lung	Associate	16410245, 17951244, 22549160, 26462147, 27556698, 29386087, 30955235, 31811797, 37620594
Carcinoma Pancreatic Ductal	Associate	21624123, 24378395, 28608476, 32376602
Carcinoma Renal Cell	Associate	11551917, 25343250, 37009792, 37024613, 37722005
Carcinoma Squamous Cell	Associate	26716504
Cardiovascular Diseases	Associate	25289457
Cataract	Associate	26617787
Cell Transformation Neoplastic	Associate	29534468
Cholangiocarcinoma	Associate	21537609, 23688168
Cleft Lip	Associate	34032749
Colonic Neoplasms	Associate	19308044, 25056432
Colorectal Neoplasms	Associate	14625275, 16551621, 18392556, 20637541, 21430067, 23144867, 25136657, 29286138, 30064309, 34109430, 36369902, 36494580
Colorectal Neoplasms	Stimulate	25171475
Coronary Disease	Associate	22510845
Crohn Disease	Associate	28011186
Crohn Disease	Stimulate	29787559
Depressive Disorder Major	Associate	25956630
Developmental Disabilities	Associate	30293988, 32109419, 37328543
Diabetes Mellitus Type 2	Associate	27912197, 33149760
Duane Retraction Syndrome	Associate	21454543
Ectodermal Dysplasia	Associate	21565291
Encephalitis	Stimulate	24571616
Endometrial Neoplasms	Associate	27409342, 27760566
Endometriosis	Associate	27041028
Esophageal Squamous Cell Carcinoma	Associate	30551505
Fanconi Anemia	Associate	26603260
Fetal Growth Retardation	Inhibit	31825077
Fibrocartilaginous embolism	Associate	22142809
Fibrosarcoma	Associate	11340084
Fibrosis	Associate	31166951, 31980676
Fistula	Associate	37328543
Gallbladder Neoplasms	Associate	33459111
Gastrointestinal Stromal Tumors	Associate	24726140
Giant Cell Tumor of Bone	Associate	29651441
Glioblastoma	Associate	19277120, 21551075, 22323579, 23775076, 28487380, 29115617, 29207169, 32186433, 39390804
Glioma	Associate	16204049, 23586025, 25310349, 26559543, 28440461, 29540255, 31213092
Granulosa cell tumor of the ovary	Associate	29651441
Hamartoma Syndrome Multiple	Inhibit	22825470
Head and Neck Neoplasms	Associate	26603260, 33848152
Hereditary Breast and Ovarian Cancer Syndrome	Associate	21172654
Hirschsprung Disease	Associate	35322726
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	35981264
Hypoxia	Stimulate	21357506, 21980400, 23185433, 31462898, 31931758, 32671953
Hypoxia	Associate	31462898, 36675278
Hypoxia	Inhibit	32587469
Hypoxia Brain	Associate	31462898
Infections	Stimulate	21881052, 40353220
Inflammation	Associate	22863953, 29845217, 30562745
Insulinoma	Associate	27912197
Intellectual Disability	Associate	33660564
Kidney Failure Chronic	Associate	26841219
Leukemia	Associate	12393632, 31857649
Leukemia Myeloid	Associate	29762824
Leukemia Myeloid Acute	Associate	26419938, 34172833
Liver Failure	Associate	30182377
Lung Diseases	Associate	32457348
Lung Neoplasms	Associate	12714585, 19154401, 22549160, 26462147, 31811797, 32457348, 34731623, 37748077
Lymphatic Metastasis	Associate	20426825, 37132640
Lymphatic Metastasis	Stimulate	23298303
Lymphoma	Associate	26430964
Lymphoma Follicular	Associate	25641953
Lymphoma Large B Cell Diffuse	Associate	25641953, 36375119, 36552804
Malignant hyperthermia susceptibility type 1	Associate	23534724
Medulloblastoma	Associate	21076938
Melanoma	Associate	12482591, 22817889, 22842228, 24531394, 24690323, 25056119, 25452114, 25465943, 26176707, 26248315, 27699663, 27890785, 29342889, 29432733, 31980996, 33848152, 37217516, 38243078 View all (3 more)
Melanoma	Stimulate	29342889
Melanoma Cutaneous Malignant	Associate	26176707, 26744134, 35534866
Meningioma	Associate	26219339
Meningism	Associate	22451524
Mesothelioma Malignant	Associate	29845703
Metabolic Syndrome	Associate	28191276
Mevalonate Kinase Deficiency	Associate	18684863, 20814828, 25107911
Mitochondrial Diseases	Associate	27912197
Mouth Neoplasms	Associate	25091805
Multiple Myeloma	Associate	40481899
Multiple Sclerosis	Associate	15048733
Myelodysplastic Syndromes	Associate	24719867, 28130497
Myocardial Infarction	Associate	31698570
Myositis	Associate	28410221
Neoplasm Invasiveness	Associate	19473989, 20426825
Neoplasm Metastasis	Associate	17406026, 19154401, 20426825, 20606682, 21295525, 21430067, 22549160, 23298303, 25458952, 26462147, 27902969, 28410221, 28671041, 29099290, 29286138 View all (12 more)
Neoplasm Metastasis	Inhibit	24378395, 37672720
Neoplasms	Associate	10982819, 12482591, 15160999, 15928809, 15965266, 19074832, 20067638, 20426825, 21076938, 21118977, 21295525, 21943101, 23285024, 23322732, 23382236 View all (50 more)
Neoplasms	Inhibit	21357506
Neoplasms	Stimulate	21537609, 24786604
Neoplasms Germ Cell and Embryonal	Associate	27646943
Nephrosclerosis	Stimulate	22129502
Nephrotic Syndrome	Stimulate	34569252
Nerve Degeneration	Associate	22142809, 37672720
Neurilemmoma	Associate	18445079, 19409384
Neurodegenerative Diseases	Associate	33848152
Neurologic Manifestations	Associate	25289457
Non alcoholic Fatty Liver Disease	Associate	29620197
Obesity	Associate	22421922
Oncogene Addiction	Associate	17167184
Orofacial Cleft 1	Associate	26561393
Osteoglophonic dwarfism	Associate	37672720
Osteosarcoma	Associate	24971902, 27222381, 28244849, 35682879
Ovarian Neoplasms	Associate	20237902, 24819662, 26071482, 29099290
Overweight	Associate	22421922
Pancreatic Neoplasms	Associate	18472958, 22745590, 23322732, 25344910, 25915428, 27145964, 28410221, 29596435, 34782370
Pancreatitis	Associate	27100492
Papilloma	Stimulate	17592548
Papilloma	Associate	20131316
Personality Disorders	Associate	23681745
Personality Disorders	Stimulate	32817335
Plaque Atherosclerotic	Associate	21134286
Polydactyly	Associate	37328543
Prostatic Hyperplasia	Associate	40392613
Prostatic Neoplasms	Associate	23300597, 24505114, 26207671, 29462661, 30078221, 31995655, 32817335, 32822124
Prostatitis	Inhibit	24681666
Pulmonary Fibrosis	Associate	34080651
Pyruvate Carboxylase Deficiency Disease	Inhibit	22825470
Recurrence	Stimulate	34569252
Renal Insufficiency	Stimulate	22129502
Renal Insufficiency	Associate	26841219
Retinal Dysplasia	Associate	12865273, 23298303
Rhabdomyosarcoma	Associate	33199827
Rotavirus Infections	Associate	29920300
Sarcoma	Associate	23382236
Sarcoma Ewing	Associate	20606682, 23681745, 27835596
Sarcoma Kaposi	Stimulate	21881052
Schizophrenia	Associate	25956630
Scimitar Syndrome	Associate	37328543
Scoliosis	Associate	37328543
Skin Neoplasms	Associate	27699663
Spondylometaepiphyseal Dysplasia Short Limb Hand Type	Associate	37047360
Squamous Cell Carcinoma of Head and Neck	Associate	24786604, 26752742, 29240723, 31427592, 32823607, 36990154
Squamous Intraepithelial Lesions	Stimulate	22443139
Status Asthmaticus	Inhibit	29228930
Stomach Neoplasms	Associate	18246045, 19497102, 23298303, 28099468, 30064133, 32147678, 37434402, 38508474
Tertiary Lymphoid Structures	Stimulate	26142737
Testicular Germ Cell Tumor	Associate	17167184
Thyroid Cancer Papillary	Associate	28234980
Thyroid Carcinoma Anaplastic	Associate	29236027, 29615459, 30171257, 31991166
Tongue Neoplasms	Associate	37132640
Triple Negative Breast Neoplasms	Associate	27902969, 32495883, 35490208, 36693952
Tukel syndrome	Stimulate	28423716
Upton Young syndrome	Associate	24531394
Urinary Bladder Neoplasms	Associate	36045117
Uterine Cervical Neoplasms	Inhibit	18253510
Uterine Cervical Neoplasms	Associate	22443139, 23760915, 30962261
Uterine Cervicitis	Associate	22443139
Vaccinia	Stimulate	15140980
VACTERL association	Associate	37328543
Van der Woude syndrome	Associate	33994351
Vasculitis	Associate	29993181
Wiskott Aldrich Syndrome	Associate	14752106
X Linked Infantile Nystagmus	Associate	23946638

RAC1 (Rac family small GTPase 1)