Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5873
Gene name	RAB27A, member RAS oncogene family
Gene symbol	RAB27A
Synonyms (NCBI Gene)	GS2HsT18676RAB27RAM
Chromosome	15
Chromosome location	15q21.3
Summary	The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscell

Show/Hide all (17)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28938176	A>C	Pathogenic	Missense variant, coding sequence variant
rs104894497	C>G,T	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs104894498	A>G	Pathogenic	Missense variant, coding sequence variant
rs104894499	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs104894500	G>A,T	Pathogenic	Missense variant, coding sequence variant, stop gained
rs141281020	A>G	Pathogenic	Initiator codon variant, missense variant
rs182849552	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs200956636	G>A	Pathogenic	Coding sequence variant, stop gained
rs753966933	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs756071120	C>G	Likely-pathogenic	Splice donor variant
rs766575263	CT>-	Pathogenic	Frameshift variant, coding sequence variant
rs767481076	GGCTT>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs770601673	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555394745	CA>-	Pathogenic	Stop gained, coding sequence variant, inframe indel
rs1595693254	AG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1595695268	T>C	Pathogenic	Intron variant
rs1595700039	AG>-	Pathogenic	Coding sequence variant, frameshift variant

370

Show/Hide all (370)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022236	hsa-miR-124-3p	Microarray	18668037
MIRT024773	hsa-miR-215-5p	Microarray	19074876
MIRT026172	hsa-miR-192-5p	Microarray	19074876
MIRT028890	hsa-miR-26b-5p	Microarray	19088304
MIRT053752	hsa-miR-31-5p	ImmunoblotImmunohistochemistryLuciferase reporter assayqRT-PCR	22948084
MIRT438829	hsa-miR-582-5p	qRT-PCR	23295946
MIRT438824	hsa-miR-582-3p	qRT-PCR	23295946
MIRT438829	hsa-miR-582-5p	qRT-PCR	23295946
MIRT438824	hsa-miR-582-3p	qRT-PCR	23295946
MIRT671540	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT671539	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT671538	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT671537	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT671536	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT671535	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT671534	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT671533	hsa-miR-1281	HITS-CLIP	23824327
MIRT671532	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT671531	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT671530	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT671529	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT671528	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT671527	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT671526	hsa-miR-4284	HITS-CLIP	23824327
MIRT637055	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT637054	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT637053	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT637052	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT637051	hsa-miR-4279	HITS-CLIP	23824327
MIRT637050	hsa-miR-3672	HITS-CLIP	23824327
MIRT637049	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT637048	hsa-miR-8055	HITS-CLIP	23824327
MIRT637047	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT637055	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT637054	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT637053	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT637052	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT637051	hsa-miR-4279	HITS-CLIP	23824327
MIRT637050	hsa-miR-3672	HITS-CLIP	23824327
MIRT637049	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT637048	hsa-miR-8055	HITS-CLIP	23824327
MIRT637047	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT671540	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT671539	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT671538	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT671537	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT671536	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT671535	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT671534	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT671533	hsa-miR-1281	HITS-CLIP	23824327
MIRT671532	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT671531	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT671530	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT671529	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT671528	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT671527	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT671526	hsa-miR-4284	HITS-CLIP	23824327
MIRT637055	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT637054	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT637053	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT637052	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT637051	hsa-miR-4279	HITS-CLIP	23824327
MIRT637050	hsa-miR-3672	HITS-CLIP	23824327
MIRT637049	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT637048	hsa-miR-8055	HITS-CLIP	23824327
MIRT637047	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT439839	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439839	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT731944	hsa-miR-134-5p	Luciferase reporter assay	28043921
MIRT731944	hsa-miR-134-5p	Luciferase reporter assay	28043921
MIRT731944	hsa-miR-134-5p	Luciferase reporter assay	28043921
MIRT731944	hsa-miR-134-5p	Luciferase reporter assay	28043921
MIRT438829	hsa-miR-582-5p	Luciferase reporter assayqRT-PCRWestern blot	26384136
MIRT637047	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT637050	hsa-miR-3672	HITS-CLIP	27418678
MIRT637051	hsa-miR-4279	HITS-CLIP	27418678
MIRT637053	hsa-miR-4524a-3p	HITS-CLIP	27418678
MIRT637055	hsa-miR-4797-5p	HITS-CLIP	27418678
MIRT637054	hsa-miR-5007-5p	HITS-CLIP	27418678
MIRT637052	hsa-miR-6780a-3p	HITS-CLIP	27418678
MIRT637049	hsa-miR-6864-3p	HITS-CLIP	27418678
MIRT637048	hsa-miR-8055	HITS-CLIP	27418678
MIRT732766	hsa-miR-186-5p	Luciferase reporter assayqRT-PCRWestern blotting	34291859
MIRT022236	hsa-miR-124-3p	Luciferase reporter assayWestern blottingqRT-PCR	32974168
MIRT022236	hsa-miR-124-3p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	32815642
MIRT671540	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT671539	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT671538	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT671537	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT671536	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT671535	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT671534	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT671533	hsa-miR-1281	HITS-CLIP	23824327
MIRT671532	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT671531	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT671530	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT671529	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT671528	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT671527	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT671526	hsa-miR-4284	HITS-CLIP	23824327
MIRT637055	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT637054	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT637053	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT637052	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT637051	hsa-miR-4279	HITS-CLIP	23824327
MIRT637050	hsa-miR-3672	HITS-CLIP	23824327
MIRT637049	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT637048	hsa-miR-8055	HITS-CLIP	23824327
MIRT637047	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT637055	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT637054	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT637053	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT637052	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT637051	hsa-miR-4279	HITS-CLIP	23824327
MIRT637050	hsa-miR-3672	HITS-CLIP	23824327
MIRT637049	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT637048	hsa-miR-8055	HITS-CLIP	23824327
MIRT637047	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT671540	hsa-miR-122-3p	HITS-CLIP	23824327
MIRT671539	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT671538	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT671537	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT671536	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT671535	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT671534	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT671533	hsa-miR-1281	HITS-CLIP	23824327
MIRT671532	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT671531	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT671530	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT671529	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT671528	hsa-miR-2276-3p	HITS-CLIP	23824327
MIRT671527	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT671526	hsa-miR-4284	HITS-CLIP	23824327
MIRT637055	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT637054	hsa-miR-5007-5p	HITS-CLIP	23824327
MIRT637053	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT637052	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT637051	hsa-miR-4279	HITS-CLIP	23824327
MIRT637050	hsa-miR-3672	HITS-CLIP	23824327
MIRT637049	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT637048	hsa-miR-8055	HITS-CLIP	23824327
MIRT637047	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT756280	hsa-miR-493-5p	Luciferase reporter assayNorthern blotting	37249278
MIRT756376	hsa-miR-4454	Luciferase reporter assay	34777698
MIRT1282956	hsa-miR-1193	CLIP-seq
MIRT1282957	hsa-miR-1208	CLIP-seq
MIRT1282958	hsa-miR-125a-3p	CLIP-seq
MIRT1282959	hsa-miR-128	CLIP-seq
MIRT1282960	hsa-miR-1298	CLIP-seq
MIRT1282961	hsa-miR-1976	CLIP-seq
MIRT1282962	hsa-miR-2392	CLIP-seq
MIRT1282963	hsa-miR-27a	CLIP-seq
MIRT1282964	hsa-miR-27b	CLIP-seq
MIRT1282965	hsa-miR-3064-3p	CLIP-seq
MIRT1282966	hsa-miR-3115	CLIP-seq
MIRT1282967	hsa-miR-3152-3p	CLIP-seq
MIRT1282968	hsa-miR-3168	CLIP-seq
MIRT1282969	hsa-miR-3190	CLIP-seq
MIRT1282970	hsa-miR-3199	CLIP-seq
MIRT1282971	hsa-miR-3202	CLIP-seq
MIRT1282972	hsa-miR-3681	CLIP-seq
MIRT1282973	hsa-miR-3934	CLIP-seq
MIRT1282974	hsa-miR-4277	CLIP-seq
MIRT1282975	hsa-miR-4290	CLIP-seq
MIRT1282976	hsa-miR-4420	CLIP-seq
MIRT756376	hsa-miR-4454	CLIP-seq
MIRT1282977	hsa-miR-4466	CLIP-seq
MIRT1282978	hsa-miR-4480	CLIP-seq
MIRT1282979	hsa-miR-4533	CLIP-seq
MIRT1282980	hsa-miR-4662a-5p	CLIP-seq
MIRT1282981	hsa-miR-4667-3p	CLIP-seq
MIRT1282982	hsa-miR-4676-5p	CLIP-seq
MIRT1282983	hsa-miR-4705	CLIP-seq
MIRT1282984	hsa-miR-4715-3p	CLIP-seq
MIRT1282985	hsa-miR-4717-5p	CLIP-seq
MIRT1282986	hsa-miR-4776-3p	CLIP-seq
MIRT1282987	hsa-miR-552	CLIP-seq
MIRT1282988	hsa-miR-575	CLIP-seq
MIRT1282989	hsa-miR-664	CLIP-seq
MIRT1282990	hsa-miR-675	CLIP-seq
MIRT1282991	hsa-miR-764	CLIP-seq
MIRT1282992	hsa-miR-892a	CLIP-seq
MIRT1282993	hsa-miR-1285	CLIP-seq
MIRT1282994	hsa-miR-217	CLIP-seq
MIRT1282995	hsa-miR-2861	CLIP-seq
MIRT1282996	hsa-miR-3156-5p	CLIP-seq
MIRT1282997	hsa-miR-3187-5p	CLIP-seq
MIRT1282998	hsa-miR-323-3p	CLIP-seq
MIRT1282999	hsa-miR-326	CLIP-seq
MIRT1283000	hsa-miR-330-5p	CLIP-seq
MIRT737858	hsa-miR-3646	CLIP-seq
MIRT1283001	hsa-miR-378g	CLIP-seq
MIRT737860	hsa-miR-4432	CLIP-seq
MIRT1283002	hsa-miR-4486	CLIP-seq
MIRT1283003	hsa-miR-4522	CLIP-seq
MIRT737861	hsa-miR-499-5p	CLIP-seq
MIRT737859	hsa-miR-5096	CLIP-seq
MIRT1283004	hsa-miR-612	CLIP-seq
MIRT1282956	hsa-miR-1193	CLIP-seq
MIRT1282957	hsa-miR-1208	CLIP-seq
MIRT1283005	hsa-miR-124	CLIP-seq
MIRT1282961	hsa-miR-1976	CLIP-seq
MIRT1282962	hsa-miR-2392	CLIP-seq
MIRT1282965	hsa-miR-3064-3p	CLIP-seq
MIRT1282966	hsa-miR-3115	CLIP-seq
MIRT1282967	hsa-miR-3152-3p	CLIP-seq
MIRT1282968	hsa-miR-3168	CLIP-seq
MIRT1282969	hsa-miR-3190	CLIP-seq
MIRT1282971	hsa-miR-3202	CLIP-seq
MIRT1282972	hsa-miR-3681	CLIP-seq
MIRT1283006	hsa-miR-3714	CLIP-seq
MIRT1283007	hsa-miR-376c	CLIP-seq
MIRT1283008	hsa-miR-3908	CLIP-seq
MIRT1283009	hsa-miR-3910	CLIP-seq
MIRT1283010	hsa-miR-3926	CLIP-seq
MIRT1282973	hsa-miR-3934	CLIP-seq
MIRT1283011	hsa-miR-411	CLIP-seq
MIRT1282974	hsa-miR-4277	CLIP-seq
MIRT1282975	hsa-miR-4290	CLIP-seq
MIRT1282976	hsa-miR-4420	CLIP-seq
MIRT756376	hsa-miR-4454	CLIP-seq
MIRT1282979	hsa-miR-4533	CLIP-seq
MIRT1283012	hsa-miR-4635	CLIP-seq
MIRT1282980	hsa-miR-4662a-5p	CLIP-seq
MIRT1282981	hsa-miR-4667-3p	CLIP-seq
MIRT1282982	hsa-miR-4676-5p	CLIP-seq
MIRT1282984	hsa-miR-4715-3p	CLIP-seq
MIRT1282986	hsa-miR-4776-3p	CLIP-seq
MIRT1283013	hsa-miR-506	CLIP-seq
MIRT1283014	hsa-miR-5095	CLIP-seq
MIRT1283015	hsa-miR-526b	CLIP-seq
MIRT1283016	hsa-miR-548s	CLIP-seq
MIRT1282987	hsa-miR-552	CLIP-seq
MIRT1283017	hsa-miR-568	CLIP-seq
MIRT1283018	hsa-miR-570	CLIP-seq
MIRT1282988	hsa-miR-575	CLIP-seq
MIRT1283019	hsa-miR-579	CLIP-seq
MIRT1283020	hsa-miR-659	CLIP-seq
MIRT1282992	hsa-miR-892a	CLIP-seq
MIRT737858	hsa-miR-3646	CLIP-seq
MIRT737860	hsa-miR-4432	CLIP-seq
MIRT737861	hsa-miR-499-5p	CLIP-seq
MIRT737859	hsa-miR-5096	CLIP-seq
MIRT2083854	hsa-miR-3145-3p	CLIP-seq
MIRT1282976	hsa-miR-4420	CLIP-seq
MIRT2309035	hsa-miR-101	CLIP-seq
MIRT2309036	hsa-miR-106a	CLIP-seq
MIRT2309037	hsa-miR-106b	CLIP-seq
MIRT1282956	hsa-miR-1193	CLIP-seq
MIRT2309038	hsa-miR-1200	CLIP-seq
MIRT1282957	hsa-miR-1208	CLIP-seq
MIRT2309039	hsa-miR-122	CLIP-seq
MIRT2309040	hsa-miR-1234	CLIP-seq
MIRT2309041	hsa-miR-1307	CLIP-seq
MIRT2309042	hsa-miR-144	CLIP-seq
MIRT2309043	hsa-miR-150	CLIP-seq
MIRT2309044	hsa-miR-17	CLIP-seq
MIRT2309045	hsa-miR-1915	CLIP-seq
MIRT1282961	hsa-miR-1976	CLIP-seq
MIRT2309046	hsa-miR-20a	CLIP-seq
MIRT2309047	hsa-miR-20b	CLIP-seq
MIRT2309048	hsa-miR-2276	CLIP-seq
MIRT1282962	hsa-miR-2392	CLIP-seq
MIRT2309049	hsa-miR-302a	CLIP-seq
MIRT2309050	hsa-miR-302b	CLIP-seq
MIRT2309051	hsa-miR-302c	CLIP-seq
MIRT2309052	hsa-miR-302d	CLIP-seq
MIRT2309053	hsa-miR-302e	CLIP-seq
MIRT2309054	hsa-miR-3135b	CLIP-seq
MIRT1282967	hsa-miR-3152-3p	CLIP-seq
MIRT1282970	hsa-miR-3199	CLIP-seq
MIRT2309055	hsa-miR-3652	CLIP-seq
MIRT2309056	hsa-miR-372	CLIP-seq
MIRT2309057	hsa-miR-373	CLIP-seq
MIRT1283007	hsa-miR-376c	CLIP-seq
MIRT1283011	hsa-miR-411	CLIP-seq
MIRT1282975	hsa-miR-4290	CLIP-seq
MIRT2309058	hsa-miR-4324	CLIP-seq
MIRT1282976	hsa-miR-4420	CLIP-seq
MIRT2309059	hsa-miR-4430	CLIP-seq
MIRT756376	hsa-miR-4454	CLIP-seq
MIRT1282980	hsa-miR-4662a-5p	CLIP-seq
MIRT1282981	hsa-miR-4667-3p	CLIP-seq
MIRT1282982	hsa-miR-4676-5p	CLIP-seq
MIRT2309060	hsa-miR-4717-3p	CLIP-seq
MIRT2309061	hsa-miR-4722-3p	CLIP-seq
MIRT2309062	hsa-miR-4731-5p	CLIP-seq
MIRT2309063	hsa-miR-512-3p	CLIP-seq
MIRT2309064	hsa-miR-519d	CLIP-seq
MIRT2309065	hsa-miR-520a-3p	CLIP-seq
MIRT2309066	hsa-miR-520b	CLIP-seq
MIRT2309067	hsa-miR-520c-3p	CLIP-seq
MIRT2309068	hsa-miR-520d-3p	CLIP-seq
MIRT2309069	hsa-miR-520e	CLIP-seq
MIRT2309070	hsa-miR-520g	CLIP-seq
MIRT2309071	hsa-miR-520h	CLIP-seq
MIRT2309072	hsa-miR-544b	CLIP-seq
MIRT1282987	hsa-miR-552	CLIP-seq
MIRT1282988	hsa-miR-575	CLIP-seq
MIRT1282992	hsa-miR-892a	CLIP-seq
MIRT2309073	hsa-miR-93	CLIP-seq
MIRT2309039	hsa-miR-122	CLIP-seq
MIRT2309041	hsa-miR-1307	CLIP-seq
MIRT2309048	hsa-miR-2276	CLIP-seq
MIRT2309054	hsa-miR-3135b	CLIP-seq
MIRT2457590	hsa-miR-320a	CLIP-seq
MIRT2457591	hsa-miR-320b	CLIP-seq
MIRT2457592	hsa-miR-320c	CLIP-seq
MIRT2457593	hsa-miR-320d	CLIP-seq
MIRT2309055	hsa-miR-3652	CLIP-seq
MIRT2457594	hsa-miR-4429	CLIP-seq
MIRT2309059	hsa-miR-4430	CLIP-seq
MIRT2457595	hsa-miR-4699-3p	CLIP-seq
MIRT2457596	hsa-miR-4772-3p	CLIP-seq
MIRT2457597	hsa-miR-520d-5p	CLIP-seq
MIRT2457598	hsa-miR-524-5p	CLIP-seq
MIRT2309039	hsa-miR-122	CLIP-seq
MIRT2309041	hsa-miR-1307	CLIP-seq
MIRT2605900	hsa-miR-146b-3p	CLIP-seq
MIRT2605901	hsa-miR-183	CLIP-seq
MIRT2605902	hsa-miR-190	CLIP-seq
MIRT2605903	hsa-miR-190b	CLIP-seq
MIRT2309045	hsa-miR-1915	CLIP-seq
MIRT1282961	hsa-miR-1976	CLIP-seq
MIRT1282994	hsa-miR-217	CLIP-seq
MIRT2309048	hsa-miR-2276	CLIP-seq
MIRT2309054	hsa-miR-3135b	CLIP-seq
MIRT2605904	hsa-miR-3173-5p	CLIP-seq
MIRT2605905	hsa-miR-3607-3p	CLIP-seq
MIRT2605906	hsa-miR-3613-5p	CLIP-seq
MIRT2605907	hsa-miR-3622b-5p	CLIP-seq
MIRT2309055	hsa-miR-3652	CLIP-seq
MIRT2605908	hsa-miR-3668	CLIP-seq
MIRT2605909	hsa-miR-3671	CLIP-seq
MIRT2605910	hsa-miR-4282	CLIP-seq
MIRT2605911	hsa-miR-4418	CLIP-seq
MIRT2309059	hsa-miR-4430	CLIP-seq
MIRT2605912	hsa-miR-4719	CLIP-seq
MIRT2309061	hsa-miR-4722-3p	CLIP-seq
MIRT2605913	hsa-miR-4725-5p	CLIP-seq
MIRT2605914	hsa-miR-4762-5p	CLIP-seq
MIRT2605915	hsa-miR-4781-3p	CLIP-seq
MIRT2605916	hsa-miR-4782-5p	CLIP-seq
MIRT2605917	hsa-miR-4793-3p	CLIP-seq
MIRT2605918	hsa-miR-504	CLIP-seq
MIRT2605919	hsa-miR-509-3-5p	CLIP-seq
MIRT2605920	hsa-miR-509-5p	CLIP-seq
MIRT2605921	hsa-miR-607	CLIP-seq
MIRT2605922	hsa-miR-627	CLIP-seq
MIRT2605923	hsa-miR-874	CLIP-seq
MIRT2605924	hsa-miR-924	CLIP-seq
MIRT2309039	hsa-miR-122	CLIP-seq
MIRT2309041	hsa-miR-1307	CLIP-seq
MIRT2309045	hsa-miR-1915	CLIP-seq
MIRT1282961	hsa-miR-1976	CLIP-seq
MIRT2309048	hsa-miR-2276	CLIP-seq
MIRT2309054	hsa-miR-3135b	CLIP-seq
MIRT2689217	hsa-miR-3156-3p	CLIP-seq
MIRT2689218	hsa-miR-3175	CLIP-seq
MIRT2309055	hsa-miR-3652	CLIP-seq
MIRT1283008	hsa-miR-3908	CLIP-seq
MIRT2689219	hsa-miR-4301	CLIP-seq
MIRT2309059	hsa-miR-4430	CLIP-seq
MIRT1282983	hsa-miR-4705	CLIP-seq
MIRT2689220	hsa-miR-4706	CLIP-seq
MIRT2309061	hsa-miR-4722-3p	CLIP-seq
MIRT2605913	hsa-miR-4725-5p	CLIP-seq
MIRT2689221	hsa-miR-4749-5p	CLIP-seq
MIRT2689222	hsa-miR-4781-5p	CLIP-seq
MIRT2605918	hsa-miR-504	CLIP-seq

Show/Hide all (72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001750	Component	Photoreceptor outer segment	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	ISS
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	12446441, 12897212, 15186776, 15548590, 16278825, 17045265, 18266782, 18812475, 22899725, 25312756, 30771381, 32296183, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	9066979
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	ISS
GO:0005576	Component	Extracellular region	TAS
GO:0005764	Component	Lysosome	IDA	15548590
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IEA
GO:0005770	Component	Late endosome	IDA	17237785, 30771381
GO:0005770	Component	Late endosome	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006887	Process	Exocytosis	IBA
GO:0006887	Process	Exocytosis	IDA	18812475
GO:0006887	Process	Exocytosis	IEA
GO:0007596	Process	Blood coagulation	IEA
GO:0009306	Process	Protein secretion	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	23092844
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019003	Function	GDP binding	IDA	20937701
GO:0019882	Process	Antigen processing and presentation	IMP	19717423
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030141	Component	Secretory granule	IBA
GO:0030141	Component	Secretory granule	IEA
GO:0030318	Process	Melanocyte differentiation	IEA
GO:0030425	Component	Dendrite	IDA	11266474
GO:0031489	Function	Myosin V binding	IEA
GO:0032400	Process	Melanosome localization	IMP	15357836
GO:0032402	Process	Melanosome transport	IEA
GO:0032402	Process	Melanosome transport	NAS	11980908
GO:0032585	Component	Multivesicular body membrane	IDA	19966785
GO:0032585	Component	Multivesicular body membrane	IEA
GO:0033093	Component	Weibel-Palade body	IEA
GO:0033162	Component	Melanosome membrane	TAS
GO:0035580	Component	Specific granule lumen	TAS
GO:0036257	Process	Multivesicular body organization	IMP	23092844
GO:0042470	Component	Melanosome	IBA
GO:0042470	Component	Melanosome	IDA	11266474, 11980908
GO:0042470	Component	Melanosome	IEA
GO:0043316	Process	Cytotoxic T cell degranulation	IEA
GO:0043320	Process	Natural killer cell degranulation	IEA
GO:0043473	Process	Pigmentation	IEA
GO:0045921	Process	Positive regulation of exocytosis	IBA
GO:0045921	Process	Positive regulation of exocytosis	IEA
GO:0045921	Process	Positive regulation of exocytosis	IMP	19966785
GO:0048489	Process	Synaptic vesicle transport	TAS	21563316
GO:0050766	Process	Positive regulation of phagocytosis	IMP	24404184
GO:0051875	Process	Pigment granule localization	IEA
GO:0051904	Process	Pigment granule transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070382	Component	Exocytic vesicle	IBA
GO:0070382	Component	Exocytic vesicle	IDA	17237785, 18812475
GO:0071985	Process	Multivesicular body sorting pathway	IEA
GO:0071985	Process	Multivesicular body sorting pathway	IMP	19966785
GO:0097278	Process	Complement-dependent cytotoxicity	IMP	24404184
GO:1903307	Process	Positive regulation of regulated secretory pathway	IGI	22899725
GO:1903307	Process	Positive regulation of regulated secretory pathway	IMP	22899725
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IMP	24404184
GO:1903435	Process	Positive regulation of constitutive secretory pathway	IMP	22899725
GO:1990182	Process	Exosomal secretion	IMP	23092844

MIM	HGNC	e!Ensembl
603868	9766	ENSG00000069974

P51159

Protein name

Ras-related protein Rab-27A (Rab-27) (EC 3.6.5.2) (GTP-binding protein Ram)

Protein function

Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate homeostasis of late endocytic pathway, including endosomal positioning, maturation and sec

PDB

6HUF , 7OPP , 7OPQ , 7OPR , 8P3G , 8P3H , 8P3I , 8P3J , 8P3K

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	11 → 183	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Found in all the examined tissues except in brain. Low expression was found in thymus, kidney, muscle and placenta. Detected in melanocytes, and in most tumor cell lines examined. Expressed in cytotoxic T-lymphocytes (CTL) and mast cel

Sequence

MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDG
ATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMH
AYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDL
IMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC

Sequence length

221

Interactions

View interactions

	Reactome
			Neutrophil degranulation RAB geranylgeranylation RAB GEFs exchange GTP for GDP on RABs

328

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autoinflammatory syndrome	Likely pathogenic; Pathogenic	rs755338751, rs761810607, rs1478402636, rs753966933, rs200956636	RCV002264291 RCV002264502 RCV002264504 RCV002263695 RCV002263709
Griscelli syndrome	Pathogenic	rs770601673	RCV000606194
Griscelli syndrome type 2	Pathogenic; Likely pathogenic	rs756644243, rs75258234, rs755338751, rs1896185846, rs765369750, rs1896186645, rs766632505, rs2140958324, rs757849893, rs2140958637, rs2140958268, rs761810607, rs1351114357, rs2140958498, rs757349638 View all (26 more)	RCV001939967 RCV001387369 RCV001387346 RCV001824257 RCV002024285 RCV002003182 RCV001909428 RCV002037857 RCV002251778 RCV002251779 RCV002251781 RCV003101471 RCV003041238 RCV003058475 RCV003064283 RCV003058476 RCV002691117 RCV002833957 RCV000006348 RCV000006349 RCV000006352 RCV000006353 RCV000006354 RCV000006356 RCV002904302 RCV002988439 RCV003228216 RCV003316894 RCV003505961 RCV003616774 RCV003616939 RCV003989945 RCV000477784 RCV000850516 RCV000499859 RCV000644917 RCV001860238 RCV000705980 RCV000793635 RCV001222124 RCV001215059 RCV005002065 RCV001251148
Multisystem inflammatory syndrome in children	Pathogenic	rs104894500	RCV001778648
RAB27A-related disorder	Pathogenic; Likely pathogenic	rs75258234, rs767481076, rs753966933	RCV004749674 RCV003983090 RCV003925404
See cases	Pathogenic; Likely pathogenic	rs104894500, rs756071120	RCV002251884 RCV002252221

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign; Likely benign; Uncertain significance	rs113895512, rs200031368	RCV005900257 RCV005909165
Clear cell carcinoma of kidney	Benign; Likely benign	rs113895512	RCV005900258
Colon adenocarcinoma	Uncertain significance	rs145253993	RCV005900256
Nonpapillary renal cell carcinoma	Uncertain significance	rs144492641	RCV005913742

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acrocephalopolydactylous Dysplasia	Associate	12058346
Adenocarcinoma	Associate	36759514
Albinism	Associate	35488210
Albinism Oculocutaneous	Associate	25312756
Albuminuria	Stimulate	32567349
Alzheimer Disease	Stimulate	21669283
Breast Neoplasms	Associate	18337447, 26178901, 34623384
Carcinoma Hepatocellular	Associate	22553406, 26305877, 34777698, 36303180
Carcinoma Non Small Cell Lung	Associate	30480360, 35136028
Chediak Higashi Syndrome	Associate	19030707, 25425525
Choroideremia	Associate	15186776, 24358126
Cognition Disorders	Stimulate	21669283
Cognitive Dysfunction	Stimulate	21669283
Colitis Ulcerative	Associate	37249278
Colorectal Neoplasms	Associate	26070933, 26760980, 36371494
Cystic Fibrosis	Associate	24934256
Death	Associate	22553406
Drug Related Side Effects and Adverse Reactions	Associate	17724145
Endocrine System Diseases	Associate	19212825
Fever	Associate	35870028
Glioma	Associate	23029308, 23553027, 24587032
Griscelli syndrome type 1	Associate	11266474, 12058346, 15475639, 16551969, 18397837, 19030707, 21169636, 21314004, 25312756, 39807742
Griscelli syndrome type 2	Associate	19030707, 19704116, 20591709, 21169636, 21314004, 24587032, 25312756, 33985578, 34058999, 35870028, 36206192, 37368332, 37388727
Griscelli syndrome type 3	Associate	18397837
Hemophagocytic lymphohistiocytosis familial 3	Associate	19704116
Hepatitis C	Associate	26305877
Hypereosinophilic Syndrome	Associate	39679991
Hypopigmentation	Associate	36243938, 37388727
Immune System Diseases	Associate	12058346
Immune System Diseases	Inhibit	37388727
Immunologic Deficiency Syndromes	Associate	19704116, 21169636, 37388727
Inflammation	Associate	18832576, 31824480, 39679991
Limb girdle muscular dystrophy type 2B	Associate	18832576
Lupus Erythematosus Systemic	Associate	34084162
Lymphatic Metastasis	Associate	26070933, 35985682
Lymphatic Metastasis	Inhibit	26760980
Lymphohistiocytosis Hemophagocytic	Associate	12058346, 17255357, 18311812, 21169636, 24916509, 25312756, 26880764, 28270454, 32542393, 34058999, 35870028, 37388727
Lymphoma	Associate	37388727
Melanoma	Associate	21129771, 22948084, 23884313, 39596498, 40038749
Muscular dystrophy congenital with central nervous system involvement	Associate	12058346
Neoplasm Metastasis	Associate	18337447, 26760980, 30480360
Neoplasms	Associate	21129771, 22553406, 26070933, 26760980, 28546229, 30480360, 36371494, 37248891, 37685910, 39596498, 40038749
Nervous System Diseases	Associate	20591709
Peritonitis	Associate	36581340
Pigmentation Disorders	Associate	25312756
Primary Immunodeficiency Diseases	Associate	38644452
Prostatitis	Associate	18413239
Proteinuria	Associate	26420894
Renal Insufficiency Chronic	Associate	26420894
Rhinitis Allergic	Associate	39679991
Sarcoma Alveolar Soft Part	Associate	37029109
Squamous Cell Carcinoma of Head and Neck	Stimulate	37685910
Status Asthmaticus	Associate	25431337
Stomach Neoplasms	Associate	28546229, 35985682
Urinary Bladder Neoplasms	Associate	22724020

RAB27A (RAB27A, member RAS oncogene family)