Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5864
Gene name Gene Name - the full gene name approved by the HGNC.	RAB3A, member RAS oncogene family
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RAB3A
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.11

Show/Hide all(89)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029766	hsa-miR-26b-5p	Microarray	19088304
MIRT733597	hsa-miR-142-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blotting	31834525
MIRT1283925	hsa-miR-1262	CLIP-seq
MIRT1283926	hsa-miR-1908	CLIP-seq
MIRT1283927	hsa-miR-1915	CLIP-seq
MIRT1283928	hsa-miR-2110	CLIP-seq
MIRT1283929	hsa-miR-3117-5p	CLIP-seq
MIRT1283930	hsa-miR-3913-3p	CLIP-seq
MIRT1283931	hsa-miR-4255	CLIP-seq
MIRT1283932	hsa-miR-4271	CLIP-seq
MIRT1283933	hsa-miR-4299	CLIP-seq
MIRT1283934	hsa-miR-4315	CLIP-seq
MIRT1283935	hsa-miR-4433	CLIP-seq
MIRT1283936	hsa-miR-4456	CLIP-seq
MIRT1283937	hsa-miR-4459	CLIP-seq
MIRT1283938	hsa-miR-4701-3p	CLIP-seq
MIRT1283939	hsa-miR-4725-3p	CLIP-seq
MIRT1283940	hsa-miR-4726-3p	CLIP-seq
MIRT1283941	hsa-miR-4768-3p	CLIP-seq
MIRT1283942	hsa-miR-4773	CLIP-seq
MIRT1283943	hsa-miR-4779	CLIP-seq
MIRT1283944	hsa-miR-4790-5p	CLIP-seq
MIRT1283945	hsa-miR-4792	CLIP-seq
MIRT1283946	hsa-miR-489	CLIP-seq
MIRT1283947	hsa-miR-491-5p	CLIP-seq
MIRT1283948	hsa-miR-514	CLIP-seq
MIRT1283949	hsa-miR-514b-3p	CLIP-seq
MIRT1283950	hsa-miR-548q	CLIP-seq
MIRT1283951	hsa-miR-615-5p	CLIP-seq
MIRT1283952	hsa-miR-637	CLIP-seq
MIRT1283953	hsa-miR-663	CLIP-seq
MIRT1283954	hsa-miR-7	CLIP-seq
MIRT2084214	hsa-miR-1207-5p	CLIP-seq
MIRT2084215	hsa-miR-140-3p	CLIP-seq
MIRT1283928	hsa-miR-2110	CLIP-seq
MIRT2084216	hsa-miR-3184	CLIP-seq
MIRT2084217	hsa-miR-423-5p	CLIP-seq
MIRT1283932	hsa-miR-4271	CLIP-seq
MIRT2084218	hsa-miR-4481	CLIP-seq
MIRT2084219	hsa-miR-4492	CLIP-seq
MIRT2084220	hsa-miR-4498	CLIP-seq
MIRT2084221	hsa-miR-4537	CLIP-seq
MIRT1283939	hsa-miR-4725-3p	CLIP-seq
MIRT2084222	hsa-miR-4736	CLIP-seq
MIRT2084223	hsa-miR-4745-5p	CLIP-seq
MIRT2084224	hsa-miR-4758-5p	CLIP-seq
MIRT2084225	hsa-miR-4763-3p	CLIP-seq
MIRT1283947	hsa-miR-491-5p	CLIP-seq
MIRT2084226	hsa-miR-762	CLIP-seq
MIRT1283926	hsa-miR-1908	CLIP-seq
MIRT1283929	hsa-miR-3117-5p	CLIP-seq
MIRT1283933	hsa-miR-4299	CLIP-seq
MIRT1283936	hsa-miR-4456	CLIP-seq
MIRT1283942	hsa-miR-4773	CLIP-seq
MIRT2439807	hsa-miR-541	CLIP-seq
MIRT1283950	hsa-miR-548q	CLIP-seq
MIRT2439808	hsa-miR-654-5p	CLIP-seq
MIRT1283953	hsa-miR-663	CLIP-seq
MIRT1283926	hsa-miR-1908	CLIP-seq
MIRT1283929	hsa-miR-3117-5p	CLIP-seq
MIRT1283933	hsa-miR-4299	CLIP-seq
MIRT1283936	hsa-miR-4456	CLIP-seq
MIRT1283942	hsa-miR-4773	CLIP-seq
MIRT2439807	hsa-miR-541	CLIP-seq
MIRT1283950	hsa-miR-548q	CLIP-seq
MIRT2439808	hsa-miR-654-5p	CLIP-seq
MIRT1283953	hsa-miR-663	CLIP-seq
MIRT2457619	hsa-miR-3121-3p	CLIP-seq
MIRT2457620	hsa-miR-338-5p	CLIP-seq
MIRT2606164	hsa-miR-1193	CLIP-seq
MIRT1283929	hsa-miR-3117-5p	CLIP-seq
MIRT2606165	hsa-miR-3691-5p	CLIP-seq
MIRT1283933	hsa-miR-4299	CLIP-seq
MIRT2606166	hsa-miR-4318	CLIP-seq
MIRT1283936	hsa-miR-4456	CLIP-seq
MIRT2606167	hsa-miR-4484	CLIP-seq
MIRT2606168	hsa-miR-4752	CLIP-seq
MIRT1283942	hsa-miR-4773	CLIP-seq
MIRT2439807	hsa-miR-541	CLIP-seq
MIRT1283950	hsa-miR-548q	CLIP-seq
MIRT2606169	hsa-miR-549	CLIP-seq
MIRT2606170	hsa-miR-590-3p	CLIP-seq
MIRT2439808	hsa-miR-654-5p	CLIP-seq
MIRT2606164	hsa-miR-1193	CLIP-seq
MIRT2606165	hsa-miR-3691-5p	CLIP-seq
MIRT2606166	hsa-miR-4318	CLIP-seq
MIRT2606168	hsa-miR-4752	CLIP-seq
MIRT2606169	hsa-miR-549	CLIP-seq
MIRT2606170	hsa-miR-590-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
NR1I2	Activation	21072196

Show/Hide all(70)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0001671	Function	ATPase activator activity	IEA
GO:0001778	Process	Plasma membrane repair	IDA	27325790
GO:0003016	Process	Respiratory system process	IEA
GO:0003924	Function	GTPase activity	IDA	24891604
GO:0003924	Function	GTPase activity	IMP	10859313
GO:0005515	Function	Protein binding	IPI	2732579, 10859313, 15207266, 24891604, 25416956, 27325790, 32296183
GO:0005525	Function	GTP binding	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0006887	Process	Exocytosis	IDA	27325790
GO:0006904	Process	Vesicle docking involved in exocytosis	IBA	21873635
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007269	Process	Neurotransmitter secretion	TAS
GO:0007274	Process	Neuromuscular synaptic transmission	IEA
GO:0007409	Process	Axonogenesis	IBA	21873635
GO:0008021	Component	Synaptic vesicle	IBA	21873635
GO:0008021	Component	Synaptic vesicle	ISS
GO:0008022	Function	Protein C-terminus binding	IEA
GO:0009306	Process	Protein secretion	IBA	21873635
GO:0009791	Process	Post-embryonic development	IEA
GO:0010807	Process	Regulation of synaptic vesicle priming	IEA
GO:0014047	Process	Glutamate secretion	TAS
GO:0014059	Process	Regulation of dopamine secretion	IEA
GO:0016079	Process	Synaptic vesicle exocytosis	ISS
GO:0016188	Process	Synaptic vesicle maturation	IEA
GO:0017157	Process	Regulation of exocytosis	IBA	21873635
GO:0030324	Process	Lung development	IEA
GO:0030424	Component	Axon	IBA	21873635
GO:0030424	Component	Axon	ISS
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030742	Function	GTP-dependent protein binding	IEA
GO:0031489	Function	Myosin V binding	IPI	24006491
GO:0031630	Process	Regulation of synaptic vesicle fusion to presynaptic active zone membrane	IBA	21873635
GO:0031630	Process	Regulation of synaptic vesicle fusion to presynaptic active zone membrane	ISS
GO:0032418	Process	Lysosome localization	IMP	2732579
GO:0032781	Process	Positive regulation of ATPase activity	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0036465	Process	Synaptic vesicle recycling	ISS
GO:0043195	Component	Terminal bouton	ISS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045054	Process	Constitutive secretory pathway	TAS	15217342
GO:0045055	Process	Regulated exocytosis	IMP	2732579
GO:0045921	Process	Positive regulation of exocytosis	TAS	15217342
GO:0048172	Process	Regulation of short-term neuronal synaptic plasticity	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	27325790
GO:0048489	Process	Synaptic vesicle transport	IEA
GO:0048786	Component	Presynaptic active zone	ISS
GO:0048790	Process	Maintenance of presynaptic active zone structure	IBA	21873635
GO:0050975	Process	Sensory perception of touch	IEA
GO:0051021	Function	GDP-dissociation inhibitor binding	IEA
GO:0051117	Function	ATPase binding	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0060201	Component	Clathrin-sculpted acetylcholine transport vesicle membrane	TAS
GO:0060203	Component	Clathrin-sculpted glutamate transport vesicle membrane	TAS
GO:0060478	Process	Acrosomal vesicle exocytosis	IDA	22248876
GO:0061202	Component	Clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane	TAS
GO:0061670	Process	Evoked neurotransmitter secretion	IEA
GO:0070083	Component	Clathrin-sculpted monoamine transport vesicle membrane	TAS
GO:0072659	Process	Protein localization to plasma membrane	IBA	21873635
GO:0097091	Process	Synaptic vesicle clustering	IEA
GO:0098993	Component	Anchored component of synaptic vesicle membrane	IBA	21873635
GO:1903307	Process	Positive regulation of regulated secretory pathway	IMP	22899725
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:1905684	Process	Regulation of plasma membrane repair	IMP	2732579
GO:2000300	Process	Regulation of synaptic vesicle exocytosis	IEA

MIM	HGNC	e!Ensembl
179490	9777	ENSG00000105649

Protein

UniProt ID

P20336

Protein name

Ras-related protein Rab-3A (EC 3.6.5.2)

Protein function

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes (PubMed:2501306). Rabs cycle between an inactive GDP-bound form and an active GTP-bound form

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	24 → 185	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in brain.

Sequence

MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQI
KTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLV
DVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC

Sequence length

220

Interactions

View interactions

	KEGG		Reactome
	Synaptic vesicle cycle Insulin secretion		Serotonin Neurotransmitter Release Cycle Norepinephrine Neurotransmitter Release Cycle Glutamate Neurotransmitter Release Cycle Dopamine Neurotransmitter Release Cycle Acetylcholine Neurotransmitter Release Cycle Neutrophil degranulation RAB geranylgeranylation RAB GEFs exchange GTP for GDP on RABs GABA synthesis, release, reuptake and degradation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Ependymoma	Ependymoma, Cellular Ependymoma	rs1555165565, rs1555993293	26075792

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Anaplastic ependymoma	Anaplastic Ependymoma		26075792	ClinVar

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining
Abnormalities Drug Induced	Associate	27641902
Albuminuria	Associate	32567349
Alzheimer Disease	Inhibit	27641902
Alzheimer Disease	Stimulate	31460748
Carcinoma Pancreatic Ductal	Associate	32759795
Creutzfeldt Jakob Disease Sporadic	Associate	23070823
Endocrine System Diseases	Associate	19212825
Neoplasms	Associate	21072196
Ovarian Neoplasms	Associate	33686173
Pheochromocytoma	Associate	2501306

RAB3A (RAB3A, member RAS oncogene family)