LY6G6D (lymphocyte antigen 6 family member G6D)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID 58530
Gene name Lymphocyte antigen 6 family member G6D
Gene symbol LY6G6D
Synonyms (NCBI Gene)
C6orf23G6DLY6-DMEGT1NG25
Chromosome 6
Chromosome location 6p21.33
Summary LY6G6D belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most
miRNA miRNA information provided by mirtarbase database.
14
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (14)
miRTarBase ID miRNA Experiments Reference
MIRT708675 hsa-miR-5088-3p HITS-CLIP 19536157
MIRT708674 hsa-miR-642b-5p HITS-CLIP 19536157
MIRT708673 hsa-miR-623 HITS-CLIP 19536157
MIRT708672 hsa-miR-204-5p HITS-CLIP 19536157
MIRT708671 hsa-miR-211-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all (20)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 33961781
GO:0005576 Component Extracellular region TAS
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0009897 Component External side of plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
606038 13935 ENSG00000244355
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95868
Protein name Lymphocyte antigen 6 complex locus protein G6d (Protein Ly6-D) (Megakaryocyte-enhanced gene transcript 1 protein)
PDB 7S4G
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen. {ECO:0000269|PubMed:12079290}.
Sequence 
MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNP
PVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAA
TALTCLLPGLWSG
Sequence length 133
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  Reactome
    Post-translational modification: synthesis of GPI-anchored proteins