LY6G6D (lymphocyte antigen 6 family member G6D)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
58530
Gene name Gene Name - the full gene name approved by the HGNC.
Lymphocyte antigen 6 family member G6D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LY6G6D
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf23, G6D, LY6-D, MEGT1, NG25
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
LY6G6D belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(14)
miRTarBase ID miRNA Experiments Reference
MIRT708675 hsa-miR-5088-3p HITS-CLIP 19536157
MIRT708674 hsa-miR-642b-5p HITS-CLIP 19536157
MIRT708673 hsa-miR-623 HITS-CLIP 19536157
MIRT708672 hsa-miR-204-5p HITS-CLIP 19536157
MIRT708671 hsa-miR-211-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(20)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 33961781
GO:0005576 Component Extracellular region TAS
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0009897 Component External side of plasma membrane IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606038 13935 ENSG00000244355
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O95868
Protein name Lymphocyte antigen 6 complex locus protein G6d (Protein Ly6-D) (Megakaryocyte-enhanced gene transcript 1 protein)
PDB 7S4G
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen. {ECO:0000269|PubMed:12079290}.
Sequence 
MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNP
PVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAA
TALTCLLPGLWSG
Sequence length 133
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Post-translational modification: synthesis of GPI-anchored proteins
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Psoriasis Psoriasis N/A N/A GWAS
Takayasu Arteritis Takayasu arteritis N/A N/A GWAS
Show/Hide Text Mining Associations (7)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 27599572
Calcinosis Cutis Stimulate 30670049
Colorectal Neoplasms Associate 26894861
Colorectal Neoplasms Stimulate 30670049
Diabetic Retinopathy Associate 33221518
Drug Related Side Effects and Adverse Reactions Stimulate 27599572
Neoplasms Associate 26894861