Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	58524
Gene name Gene Name - the full gene name approved by the HGNC.	Doublesex and mab-3 related transcription factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DMRT3
Synonyms (NCBI Gene) Gene synonyms aliases	DMRTA3
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p24.3

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018492	hsa-miR-335-5p	Microarray	18185580
MIRT939224	hsa-miR-3622a-3p	CLIP-seq
MIRT939225	hsa-miR-3622b-3p	CLIP-seq
MIRT939226	hsa-miR-4701-5p	CLIP-seq
MIRT939227	hsa-miR-588	CLIP-seq
MIRT1977848	hsa-miR-543	CLIP-seq
MIRT2213188	hsa-miR-1297	CLIP-seq
MIRT2213189	hsa-miR-26a	CLIP-seq
MIRT2213190	hsa-miR-26b	CLIP-seq
MIRT2213191	hsa-miR-33a	CLIP-seq
MIRT2213192	hsa-miR-33b	CLIP-seq
MIRT2213193	hsa-miR-4465	CLIP-seq
MIRT2213194	hsa-miR-4795-3p	CLIP-seq
MIRT2213195	hsa-miR-656	CLIP-seq
MIRT2428268	hsa-miR-3143	CLIP-seq
MIRT2428269	hsa-miR-3940-5p	CLIP-seq
MIRT2428270	hsa-miR-4507	CLIP-seq
MIRT1977848	hsa-miR-543	CLIP-seq
MIRT2428271	hsa-miR-629	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007548	Process	Sex differentiation	IBA	21873635
GO:0007548	Process	Sex differentiation	NAS	10729223
GO:0007628	Process	Adult walking behavior	IEA
GO:0019226	Process	Transmission of nerve impulse	IEA
GO:0021521	Process	Ventral spinal cord interneuron specification	IEA
GO:0042487	Process	Regulation of odontogenesis of dentin-containing tooth	IEA
GO:0046661	Process	Male sex differentiation	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
614754	13909	ENSG00000064218

Protein

UniProt ID

Q9NQL9

Protein name

Doublesex- and mab-3-related transcription factor 3

Protein function

Probable transcription factor that plays a role in configuring the spinal circuits controlling stride in vertebrates. Involved in neuronal specification within specific subdivision of spinal cord neurons and in the development of a coordinated l

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00751	DM	25 → 71	DM DNA binding domain	Family
PF03474	DMA	249 → 285	DMRTA motif	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis. {ECO:0000269|PubMed:10729223}.

Sequence

MNGYGSPYLYMGGPVSQPPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCIL
IIERQRVMAAQVALRRQQANESLESLIPDSLRALPGPPPPGDAVAAPQPPPASQPSQPQP
PRPAAELAAAAALRWTAEPQPGALQAQLAKPDLTEERLGDGKSADNTEVFSDKDTDQRSS
PDVAKSKGCFTPESPEIVSVEEGGYAVQKNGGNPESRPDSPKCHAEQNHLLIEGPSGTVS
LPFSLKANRPPLEVLKKIFPNQKPTVLELILKGCGGDLVSAVEVLLSSRSSVTGAERTSA
EPESLALPSNGHIFEHTLSSYPISSSKWSVGSAFRVPDTLRFSADSSNVVPSPLAGPLQP
PFPQPPRYPLMLRNTLARSQSSPFLPNDVTLWNTMTLQQQYQLRSQYVSPFPSNSTSVFR
SSPVLPARATEDPRISIPDDGCPFVSKQSIYTEDDYDERSDSSDSRTLNTSS

Sequence length

472

Interactions

View interactions

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID	References
Causal
46, xy partial gonadal dysgenesis	46,XY partial gonadal dysgenesis	rs193922688	17644778
Azoospermia	Azoospermia	rs200969445, rs144567652, rs765353898
Cryptorchidism	Cryptorchidism	rs121912555, rs104894697, rs104894698, rs398122886
Nephroblastoma	Nephroblastoma	rs1553551874, rs1555913934, rs769116796
Nephrotic syndrome	Nephrotic Syndrome	rs876657369, rs121912601, rs121912602, rs876657370, rs121912603, rs121912604, rs121912605, rs121907900, rs121907901, rs28941778, rs587776576, rs28942089, rs587776577, rs28941777, rs121907910 View all (152 more)
Osteoporosis	Osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Ambiguous genitalia	Ambiguous Genitalia	ClinVar
Uterine Fibroids	Uterine Fibroids	GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
46 XX Testicular Disorders of Sex Development	Associate	21482378
Carcinoma Squamous Cell	Associate	29866045
Disease Progression	Stimulate	34439758
Disorder of Sex Development 46 XY	Associate	32553473
Disorders of Sex Development	Associate	32553473
Nasal Polyps	Associate	34439758
Neoplasms	Associate	30815935
Respiratory Tract Diseases	Associate	34439758

DMRT3 (doublesex and mab-3 related transcription factor 3)