SELENOK (selenoprotein K)

Gene

• Entrez ID: 58515
• Gene name: Selenoprotein K
• Gene symbol: SELENOK
• Synonyms (NCBI Gene): HSPC030, HSPC297, SELK
• Chromosome: 3
• Chromosome location: 3p21.1
• Summary: The protein encoded by this gene belongs to the selenoprotein K family. It is a transmembrane protein that is localized in the endoplasmic reticulum (ER), and is involved in ER-associated degradation (ERAD) of misfolded, glycosylated proteins. It also has

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002230	Process	Positive regulation of defense response to virus by host	IEA
GO:0005515	Function	Protein binding	IPI	25368151, 32296183
GO:0005783	Component	Endoplasmic reticulum	IDA	16962588, 25368151
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	21220695
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IBA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0006979	Process	Response to oxidative stress	IMP	16962588
GO:0010742	Process	Macrophage derived foam cell differentiation	IEA
GO:0016020	Component	Membrane	IEA
GO:0018345	Process	Protein palmitoylation	IDA	25368151
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	IBA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042802	Function	Identical protein binding	IPI	25117454
GO:0045728	Process	Respiratory burst after phagocytosis	IEA
GO:0050848	Process	Regulation of calcium-mediated signaling	IEA
GO:0051223	Process	Regulation of protein transport	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	20692228
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IEA
GO:0072678	Process	T cell migration	IEA
GO:1902624	Process	Positive regulation of neutrophil migration	IEA
GO:1990266	Process	Neutrophil migration	IEA
GO:2000406	Process	Positive regulation of T cell migration	IEA

Other IDs

• MIM: 607916
• HGNC: 30394
• e!Ensembl: ENSG00000113811

Protein

• UniProt ID: Q9Y6D0
• Protein name: Selenoprotein K (SelK)
• Protein function: Required for Ca(2+) flux in immune cells and plays a role in T-cell proliferation and in T-cell and neutrophil migration (By similarity). Involved in endoplasmic reticulum-associated degradation (ERAD) of soluble glycosylated proteins (PubMed:22
• PDB: 6DO3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10961	SelK_SelG	2 → 91	Selenoprotein SelK_SelG	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in heart. {ECO:0000269|PubMed:16962588}.
• Sequence:

  MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRY
  DDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR

• Sequence length: 94

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DRY EYE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC EPIDERMAL NECROLYSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Carcinoma Hepatocellular	Associate	27275761	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	23133653	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	23133653	★☆☆☆☆ Found in Text Mining only