Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	58504
Gene name	Rho GTPase activating protein 22
Gene symbol	ARHGAP22
Synonyms (NCBI Gene)	RhoGAP2RhoGap22
Chromosome	10
Chromosome location	10q11.22-q11.23
Summary	This gene encodes a member of the GTPase activating protein family which activates a GTPase belonging to the RAS superfamily of small GTP-binding proteins. The encoded protein is insulin-responsive, is dependent on the kinase Akt and requires the Akt-depe

107

Show/Hide all (107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022123	hsa-miR-124-3p	Microarray	18668037
MIRT039842	hsa-miR-615-3p	CLASH	23622248
MIRT650260	hsa-miR-1207-3p	HITS-CLIP	23824327
MIRT650259	hsa-miR-4267	HITS-CLIP	23824327
MIRT650258	hsa-miR-149-5p	HITS-CLIP	23824327
MIRT650257	hsa-miR-202-3p	HITS-CLIP	23824327
MIRT650256	hsa-miR-5580-5p	HITS-CLIP	23824327
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT491293	hsa-miR-4436a	PAR-CLIP	20371350
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	20371350
MIRT491291	hsa-miR-421	PAR-CLIP	20371350
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT491293	hsa-miR-4436a	PAR-CLIP	20371350
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	20371350
MIRT491291	hsa-miR-421	PAR-CLIP	20371350
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	22012620
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT491293	hsa-miR-4436a	PAR-CLIP	22012620
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	22012620
MIRT491291	hsa-miR-421	PAR-CLIP	22012620
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	23592263
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	23592263
MIRT491293	hsa-miR-4436a	PAR-CLIP	23592263
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	23592263
MIRT491291	hsa-miR-421	PAR-CLIP	23592263
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	26701625
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	26701625
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	26701625
MIRT491291	hsa-miR-421	PAR-CLIP	26701625
MIRT491291	hsa-miR-421	PAR-CLIP	26701625
MIRT491291	hsa-miR-421	PAR-CLIP	26701625
MIRT491293	hsa-miR-4436a	PAR-CLIP	26701625
MIRT491293	hsa-miR-4436a	PAR-CLIP	26701625
MIRT491293	hsa-miR-4436a	PAR-CLIP	26701625
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	26701625
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	26701625
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	26701625
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	26701625
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	26701625
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	26701625
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	27292025
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	27292025
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	27292025
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	27292025
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	27292025
MIRT491291	hsa-miR-421	PAR-CLIP	27292025
MIRT491291	hsa-miR-421	PAR-CLIP	27292025
MIRT491291	hsa-miR-421	PAR-CLIP	27292025
MIRT491291	hsa-miR-421	PAR-CLIP	27292025
MIRT491291	hsa-miR-421	PAR-CLIP	27292025
MIRT491293	hsa-miR-4436a	PAR-CLIP	27292025
MIRT491293	hsa-miR-4436a	PAR-CLIP	27292025
MIRT491293	hsa-miR-4436a	PAR-CLIP	27292025
MIRT491293	hsa-miR-4436a	PAR-CLIP	27292025
MIRT491293	hsa-miR-4436a	PAR-CLIP	27292025
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	27292025
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	27292025
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	27292025
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	27292025
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	27292025
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	27292025
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	27292025
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	27292025
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	27292025
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	27292025
MIRT650260	hsa-miR-1207-3p	HITS-CLIP	23824327
MIRT650259	hsa-miR-4267	HITS-CLIP	23824327
MIRT650258	hsa-miR-149-5p	HITS-CLIP	23824327
MIRT650257	hsa-miR-202-3p	HITS-CLIP	23824327
MIRT650256	hsa-miR-5580-5p	HITS-CLIP	23824327
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT491293	hsa-miR-4436a	PAR-CLIP	20371350
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	20371350
MIRT491291	hsa-miR-421	PAR-CLIP	20371350
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	20371350
MIRT491293	hsa-miR-4436a	PAR-CLIP	20371350
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	20371350
MIRT491291	hsa-miR-421	PAR-CLIP	20371350
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	22012620
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	22012620
MIRT491293	hsa-miR-4436a	PAR-CLIP	22012620
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	22012620
MIRT491291	hsa-miR-421	PAR-CLIP	22012620
MIRT491295	hsa-miR-1178-5p	PAR-CLIP	23592263
MIRT491294	hsa-miR-4709-5p	PAR-CLIP	23592263
MIRT491293	hsa-miR-4436a	PAR-CLIP	23592263
MIRT491292	hsa-miR-5000-3p	PAR-CLIP	23592263
MIRT491291	hsa-miR-421	PAR-CLIP	23592263
MIRT794096	hsa-miR-3064-5p	CLIP-seq
MIRT794097	hsa-miR-4756-3p	CLIP-seq
MIRT794098	hsa-miR-520a-5p	CLIP-seq
MIRT794099	hsa-miR-525-5p	CLIP-seq
MIRT794100	hsa-miR-604	CLIP-seq
MIRT794101	hsa-miR-647	CLIP-seq
MIRT1934342	hsa-miR-339-3p	CLIP-seq
MIRT794098	hsa-miR-520a-5p	CLIP-seq
MIRT794099	hsa-miR-525-5p	CLIP-seq
MIRT794096	hsa-miR-3064-5p	CLIP-seq
MIRT794097	hsa-miR-4756-3p	CLIP-seq
MIRT794098	hsa-miR-520a-5p	CLIP-seq
MIRT794099	hsa-miR-525-5p	CLIP-seq
MIRT794100	hsa-miR-604	CLIP-seq
MIRT794101	hsa-miR-647	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	21078624, 25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007165	Process	Signal transduction	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051058	Process	Negative regulation of small GTPase mediated signal transduction	IBA
GO:0098978	Component	Glutamatergic synapse	IDA	21926414
GO:0098978	Component	Glutamatergic synapse	IMP	21926414
GO:0099175	Process	Regulation of postsynapse organization	IBA
GO:0099175	Process	Regulation of postsynapse organization	IDA	21926414
GO:0099175	Process	Regulation of postsynapse organization	IMP	21926414

MIM	HGNC	e!Ensembl
610585	30320	ENSG00000128805

Q7Z5H3

Protein name

Rho GTPase-activating protein 22 (Rho-type GTPase-activating protein 22)

Protein function

Rho GTPase-activating protein involved in the signal transduction pathway that regulates endothelial cell capillary tube formation during angiogenesis. Acts as a GTPase activator for the RAC1 by converting it to an inactive GDP-bound state. Inhi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	38 → 144	PH domain	Domain
PF00620	RhoGAP	173 → 324	RhoGAP domain	Domain

Sequence

MLSPKIRQARRARSKSLVMGEQSRSPGRMPCPHRLGPVLKAGWLKKQRSIMKNWQQRWFV
LRGDQLFYYKDKDEIKPQGFISLQGTQVTELPPGPEDPGKHLFEISPGGAGEREKVPANP
EALLLMASSQRDMEDWVQAIRRVIWAPLGGGIFGQRLEETVHHERKYGPRLAPLLVEQCV
DFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPE
PVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSNLPQANYNLLRYICKFLDEVQAYSNV
NKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQHLMTVLIRKHSQLFTAPVPEGPTSP
RGGLQCAVGWGSEEVTRDSQGEPGGPGLPAHRTSSLDGAAVAVLSRTAPTGPGSRCSPGK
KVQTLPSWKSSFRQPRSLSGSPKGGGSSLEVPIISSGGNWLMNGLSSLRGHRRASSGDRL
KDSGSVQRLSTYDNVPAPGLVPGIPSVASMAWSGASSSESSVGGSLSSCTACRASDSSAR
SSLHTDWALEPSPLPSSSEDPKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQ
GLVTELRAELCRQRTEYERSVKRIEEGSADLRKRMSRLEEELDQEKKKYIMLEIKLRNSE
RAREDAERRNQLLQREMEEFFSTLGSLTVGAKGARAPK

Sequence length

698

Interactions

View interactions

	Reactome
			Rho GTPase cycle

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	30151992	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	36928034	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Associate	36928034	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	24526447, 27863428, 40271977	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Stimulate	27863428	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Associate	40271977	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Associate	24526447	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Associate	40271977	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	18977323	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Associate	28510328	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Associate	23299920	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	18977323	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Associate	30977211	★★★★★ ★☆☆☆☆ Found in Text Mining only

ARHGAP22 (Rho GTPase activating protein 22)