Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
58504
Gene name Gene Name - the full gene name approved by the HGNC.
Rho GTPase activating protein 22
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ARHGAP22
Synonyms (NCBI Gene) Gene synonyms aliases
RhoGAP2, RhoGap22
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q11.22-q11.23
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the GTPase activating protein family which activates a GTPase belonging to the RAS superfamily of small GTP-binding proteins. The encoded protein is insulin-responsive, is dependent on the kinase Akt and requires the Akt-depe
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022123 hsa-miR-124-3p Microarray 18668037
MIRT039842 hsa-miR-615-3p CLASH 23622248
MIRT650260 hsa-miR-1207-3p HITS-CLIP 23824327
MIRT650259 hsa-miR-4267 HITS-CLIP 23824327
MIRT650258 hsa-miR-149-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0005096 Function GTPase activator activity IBA
GO:0005096 Function GTPase activator activity IEA
GO:0005096 Function GTPase activator activity TAS
GO:0005515 Function Protein binding IPI 21078624, 25416956, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610585 30320 ENSG00000128805
Protein
UniProt ID Q7Z5H3
Protein name Rho GTPase-activating protein 22 (Rho-type GTPase-activating protein 22)
Protein function Rho GTPase-activating protein involved in the signal transduction pathway that regulates endothelial cell capillary tube formation during angiogenesis. Acts as a GTPase activator for the RAC1 by converting it to an inactive GDP-bound state. Inhi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00169 PH 38 144 PH domain Domain
PF00620 RhoGAP 173 324 RhoGAP domain Domain
Sequence
MLSPKIRQARRARSKSLVMGEQSRSPGRMPCPHRLGPVLKAGWLKKQRSIMKNWQQRWFV
LRGDQLFYYKDKDEIKPQGFISLQGTQVTELPPGPEDPGKHLFEISPGGAGEREKVPANP
EALLLMASSQRDMEDWVQAIRRVI
WAPLGGGIFGQRLEETVHHERKYGPRLAPLLVEQCV
DFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPE
PVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSNLPQANYNLLRYICKFLDEVQAYSNV
NKMSVQNLATVFGPNILRPQVEDP
VTIMEGTSLVQHLMTVLIRKHSQLFTAPVPEGPTSP
RGGLQCAVGWGSEEVTRDSQGEPGGPGLPAHRTSSLDGAAVAVLSRTAPTGPGSRCSPGK
KVQTLPSWKSSFRQPRSLSGSPKGGGSSLEVPIISSGGNWLMNGLSSLRGHRRASSGDRL
KDSGSVQRLSTYDNVPAPGLVPGIPSVASMAWSGASSSESSVGGSLSSCTACRASDSSAR
SSLHTDWALEPSPLPSSSEDPKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQ
GLVTELRAELCRQRTEYERSVKRIEEGSADLRKRMSRLEEELDQEKKKYIMLEIKLRNSE
RAREDAERRNQLLQREMEEFFSTLGSLTVGAKGARAPK
Sequence length 698
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Rho GTPase cycle
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Conduct Disorder Conduct disorder N/A N/A GWAS
Diabetic Retinopathy Diabetic retinopathy N/A N/A GWAS
Hypertension Hypertension N/A N/A GWAS
Long QT Syndrome long qt syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 30151992
Alzheimer Disease Associate 36928034
Depressive Disorder Major Associate 36928034
Diabetes Mellitus Type 2 Associate 24526447, 27863428, 40271977
Diabetes Mellitus Type 2 Stimulate 27863428
Diabetic Nephropathies Associate 40271977
Diabetic Retinopathy Associate 24526447
Kidney Diseases Associate 40271977
Melanoma Associate 18977323
Melanoma Cutaneous Malignant Associate 28510328