LY6G5B (lymphocyte antigen 6 family member G5B)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 58496
Gene name Lymphocyte antigen 6 family member G5B
Gene symbol LY6G5B
Synonyms (NCBI Gene)
C6orf19G5b
Chromosome 6
Chromosome location 6p21.33
Summary LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most
miRNA miRNA information provided by mirtarbase database.
304
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (304)
miRTarBase ID miRNA Experiments Reference
MIRT048964 hsa-miR-92a-3p CLASH 23622248
MIRT036227 hsa-miR-320b CLASH 23622248
MIRT692401 hsa-miR-106a-5p HITS-CLIP 23313552
MIRT692400 hsa-miR-106b-5p HITS-CLIP 23313552
MIRT692399 hsa-miR-17-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (6)
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0009897 Component External side of plasma membrane IBA
GO:0009897 Component External side of plasma membrane IDA 17008713
GO:0009897 Component External side of plasma membrane IEA
GO:0032991 Component Protein-containing complex IDA 17008713
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610433 13931 ENSG00000240053
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NDX9
Protein name Lymphocyte antigen 6 complex locus protein G5b
Family and domains
Sequence 
MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITI
YYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPH
DRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYL
FLNSSGLLVLPQAGLLTPHPS
Sequence length 201
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Poirier-Bienvenu neurodevelopmental syndrome Likely pathogenic rs2536958296 RCV003983759