Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
58496
Gene name Gene Name - the full gene name approved by the HGNC.
Lymphocyte antigen 6 family member G5B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LY6G5B
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf19, G5b
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT048964 hsa-miR-92a-3p CLASH 23622248
MIRT036227 hsa-miR-320b CLASH 23622248
MIRT692401 hsa-miR-106a-5p HITS-CLIP 23313552
MIRT692400 hsa-miR-106b-5p HITS-CLIP 23313552
MIRT692399 hsa-miR-17-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0009897 Component External side of plasma membrane IBA 21873635
GO:0009897 Component External side of plasma membrane IDA 17008713
GO:0032991 Component Protein-containing complex IDA 17008713
GO:0042802 Function Identical protein binding IDA 17008713
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610433 13931 ENSG00000240053
Protein
UniProt ID Q8NDX9
Protein name Lymphocyte antigen 6 complex locus protein G5b
Family and domains
Sequence
MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITI
YYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPH
DRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYL
FLNSSGLLVLPQAGLLTPHPS
Sequence length 201
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
17632545
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 21156761
Unknown
Disease term Disease name Evidence References Source
Takayasu Arteritis Takayasu Arteritis GWAS