Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	58494
Gene name Gene Name - the full gene name approved by the HGNC.	Junctional adhesion molecule 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	JAM2
Synonyms (NCBI Gene) Gene synonyms aliases	C21orf43, CD322, IBGC8, JAM-B, JAMB, PRO245, VE-JAM, VEJAM
Disease Acronyms (UniProt) Disease acronyms from UniProt database	IBGC8
Chromosome Chromosome number	21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	21q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. The protein encoded by this gene is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. It act

Show/Hide all(7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs751103286	->G	Pathogenic	Splice acceptor variant
rs781261918	C>T	Pathogenic	Stop gained, coding sequence variant, non coding transcript variant
rs1230941179	G>A,C	Pathogenic	Stop gained, non coding transcript variant, coding sequence variant, missense variant
rs1383641309	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1600978441	A>G	Pathogenic	Non coding transcript variant, initiator codon variant, missense variant, intron variant
rs1601038626	T>-	Pathogenic	Non coding transcript variant, coding sequence variant, 5 prime UTR variant, stop gained, intron variant
rs1601038704	CAGA>-	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant, 5 prime UTR variant, intron variant

Show/Hide all(28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029914	hsa-miR-26b-5p	Microarray	19088304
MIRT680675	hsa-miR-6087	HITS-CLIP	23706177
MIRT680674	hsa-miR-377-5p	HITS-CLIP	23706177
MIRT680673	hsa-miR-6086	HITS-CLIP	23706177
MIRT680672	hsa-miR-6499-3p	HITS-CLIP	23706177
MIRT680671	hsa-miR-658	HITS-CLIP	23706177
MIRT680670	hsa-miR-25-5p	HITS-CLIP	23706177
MIRT680669	hsa-miR-6825-5p	HITS-CLIP	23706177
MIRT680668	hsa-miR-6807-5p	HITS-CLIP	23706177
MIRT680667	hsa-miR-455-3p	HITS-CLIP	23706177
MIRT680666	hsa-miR-6516-5p	HITS-CLIP	23706177
MIRT680665	hsa-miR-4459	HITS-CLIP	23706177
MIRT680675	hsa-miR-6087	HITS-CLIP	23706177
MIRT680674	hsa-miR-377-5p	HITS-CLIP	23706177
MIRT680673	hsa-miR-6086	HITS-CLIP	23706177
MIRT680672	hsa-miR-6499-3p	HITS-CLIP	23706177
MIRT680671	hsa-miR-658	HITS-CLIP	23706177
MIRT680670	hsa-miR-25-5p	HITS-CLIP	23706177
MIRT680669	hsa-miR-6825-5p	HITS-CLIP	23706177
MIRT680668	hsa-miR-6807-5p	HITS-CLIP	23706177
MIRT680667	hsa-miR-455-3p	HITS-CLIP	23706177
MIRT680666	hsa-miR-6516-5p	HITS-CLIP	23706177
MIRT680665	hsa-miR-4459	HITS-CLIP	23706177
MIRT1076338	hsa-miR-3119	CLIP-seq
MIRT1076339	hsa-miR-3675-3p	CLIP-seq
MIRT1076340	hsa-miR-4509	CLIP-seq
MIRT1076341	hsa-miR-4744	CLIP-seq
MIRT1076342	hsa-miR-9	CLIP-seq

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005178	Function	Integrin binding	IDA	12070135
GO:0005515	Function	Protein binding	IPI	11590146, 11823489, 21982860
GO:0005886	Component	Plasma membrane	IMP	31851307
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IDA	11590146
GO:0005887	Component	Integral component of plasma membrane	NAS	10779521
GO:0005923	Component	Bicellular tight junction	IEA
GO:0007286	Process	Spermatid development	ISS
GO:0007520	Process	Myoblast fusion	ISS
GO:0009986	Component	Cell surface	IDA	19740376
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0031642	Process	Negative regulation of myelination	ISS
GO:0035633	Process	Maintenance of blood-brain barrier	NAS	30280653
GO:0036477	Component	Somatodendritic compartment	ISS
GO:0044291	Component	Cell-cell contact zone	IDA	12239159
GO:0045123	Process	Cellular extravasation	IDA	12239159
GO:0050900	Process	Leukocyte migration	TAS
GO:0050901	Process	Leukocyte tethering or rolling	IDA	19740376
GO:0070160	Component	Tight junction	ISS
GO:0071593	Process	Lymphocyte aggregation	IDA	11823489
GO:0097241	Process	Hematopoietic stem cell migration to bone marrow	IMP	24357068
GO:0098609	Process	Cell-cell adhesion	IMP	24357068
GO:0098609	Process	Cell-cell adhesion	NAS	10779521
GO:0098636	Component	Protein complex involved in cell adhesion	IDA	11590146
GO:2000403	Process	Positive regulation of lymphocyte migration	IDA	12239159

MIM	HGNC	e!Ensembl
606870	14686	ENSG00000154721

Protein

UniProt ID

P57087

Protein name

Junctional adhesion molecule B (JAM-B) (Junctional adhesion molecule 2) (JAM-2) (Vascular endothelial junction-associated molecule) (VE-JAM) (CD antigen CD322)

Protein function

Junctional adhesion protein that mediates heterotypic cell-cell interactions with its cognate receptor JAM3 to regulate different cellular processes (PubMed:11590146, PubMed:11823489, PubMed:24357068). Plays a role in homing and mobilization of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	33 → 131	Immunoglobulin V-set domain	Domain
PF13927	Ig_3	134 → 218		Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart, placenta, lung, foreskin and lymph node (PubMed:10779521, PubMed:10945976). Prominently expressed on high endothelial venules and also present on the endothelia of other vessels (at protein level) (PubMed:107

Sequence

MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSR
LEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQN
LEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPR
LGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGI
IAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII

Sequence length

298

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules Tight junction Leukocyte transendothelial migration Epithelial cell signaling in Helicobacter pylori infection		Cell surface interactions at the vascular wall Integrin cell surface interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Bilateral Striopallidodentate Calcinosis	bilateral striopallidodentate calcinosis			GenCC

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	27610375
Adenocarcinoma of Lung	Inhibit	39838844
Alzheimer Disease	Associate	25649652
Arrhythmogenic Right Ventricular Dysplasia	Stimulate	31843279
Asthma	Associate	31952466, 38375886
Breast Neoplasms	Associate	39270542
Calcinosis	Associate	36862146
Carcinoma Hepatocellular	Associate	36038676
Colorectal Neoplasms	Associate	25997610, 26782073
Down Syndrome	Associate	38095646
Epilepsy	Associate	37246165
Esophageal Squamous Cell Carcinoma	Associate	26004606
Fahr's disease	Associate	33793087, 36862146, 39740729
Idiopathic Pulmonary Fibrosis	Associate	31952466
Inflammation	Associate	28206970, 39838844
Multiple Myeloma	Associate	36867577
Neoplasm Metastasis	Associate	26782073
Neoplasms	Associate	22193974, 26782073, 36782375, 39270542, 39838844
Non alcoholic Fatty Liver Disease	Associate	28206970
Severe Acute Respiratory Syndrome	Associate	38375886
Stomach Neoplasms	Associate	26330360, 33015704

JAM2 (junctional adhesion molecule 2)