ABHD17C (abhydrolase domain containing 17C, depalmitoylase)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
58489
Gene name Gene Name - the full gene name approved by the HGNC.
Abhydrolase domain containing 17C, depalmitoylase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ABHD17C
Synonyms (NCBI Gene) Gene synonyms aliases
FAM108C1
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q25.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(106)
miRTarBase ID miRNA Experiments Reference
MIRT021539 hsa-miR-145-5p Reporter assay;Microarray 21351259
MIRT021917 hsa-miR-128-3p Sequencing 20371350
MIRT027303 hsa-miR-101-3p Sequencing 20371350
MIRT028741 hsa-miR-27a-3p Sequencing 20371350
MIRT047033 hsa-miR-183-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(25)
GO ID Ontology Definition Evidence Reference
GO:0002084 Process Protein depalmitoylation IGI 26701913
GO:0002084 Process Protein depalmitoylation IMP 26701913
GO:0005515 Function Protein binding IPI 32814053
GO:0005768 Component Endosome IEA
GO:0005886 Component Plasma membrane IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
617944 26925 ENSG00000136379
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q6PCB6
Protein name Alpha/beta hydrolase domain-containing protein 17C (Abhydrolase domain-containing protein 17C) (EC 3.1.2.22)
Protein function Hydrolyzes fatty acids from S-acylated cysteine residues in proteins. Has depalmitoylating activity towards NRAS and DLG4/PSD95.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12146 Hydrolase_4 129 → 249 Serine aminopeptidase, S33 Family
Sequence 
MPEPGPRMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVLAPEQRGAGASAPAPA
QATAAAAAAQPAPQQPEEGAGAGPGACSLHLSERADWQYSQRELDAVEVFFSRTARDNRL
GCMFVRCAPSSRYTLLFSHGNAVDLGQMCSFYIGLGSRINCNIFSYDYSGYGVSSGKPSE
KNLYADIDAAWQALRTRYGVSPENIILYGQSIGTVPTVDLASRYECAAVILHSPLMSGLR
VAFPDTRKTYCFDAFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYERCPRAVEPLWV
EGAGHNDIELYAQYLERLKQFISHELPNS
Sequence length 329
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (10)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Breast Cancer Breast cancer specific mortality in estrogen receptor positive breast cancer N/A N/A GWAS
Dyslexia Dyslexia N/A N/A GWAS
Heart Failure Heart failure N/A N/A GWAS
Show/Hide Text Mining Associations (2)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 38177255
Cardiovascular Diseases Associate 34083597