Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	58480
Gene name	Ras homolog family member U
Gene symbol	RHOU
Synonyms (NCBI Gene)	ARHUCDC42L1G28KWRCH1hG28K
Chromosome	1
Chromosome location	1q42.13
Summary	This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cyt

166

Show/Hide all (166)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016073	hsa-miR-374b-5p	Sequencing	20371350
MIRT053454	hsa-miR-452-5p	Microarray	23807165
MIRT438574	hsa-miR-126-3p	Luciferase reporter assayqRT-PCRWestern blot	23811937
MIRT438574	hsa-miR-126-3p	Luciferase reporter assayqRT-PCRWestern blot	23811937
MIRT1306083	hsa-miR-1279	CLIP-seq
MIRT1306084	hsa-miR-129-5p	CLIP-seq
MIRT1306085	hsa-miR-1304	CLIP-seq
MIRT1306086	hsa-miR-134	CLIP-seq
MIRT1306087	hsa-miR-2467-3p	CLIP-seq
MIRT1306088	hsa-miR-2682	CLIP-seq
MIRT1306089	hsa-miR-3118	CLIP-seq
MIRT1306090	hsa-miR-3121-3p	CLIP-seq
MIRT1306091	hsa-miR-3164	CLIP-seq
MIRT1306092	hsa-miR-329	CLIP-seq
MIRT1306093	hsa-miR-330-3p	CLIP-seq
MIRT1306094	hsa-miR-337-3p	CLIP-seq
MIRT1306095	hsa-miR-3609	CLIP-seq
MIRT1306096	hsa-miR-362-3p	CLIP-seq
MIRT1306097	hsa-miR-3659	CLIP-seq
MIRT1306098	hsa-miR-3674	CLIP-seq
MIRT1306099	hsa-miR-3691-5p	CLIP-seq
MIRT1306100	hsa-miR-369-3p	CLIP-seq
MIRT1306101	hsa-miR-374a	CLIP-seq
MIRT1306102	hsa-miR-374b	CLIP-seq
MIRT1306103	hsa-miR-374c	CLIP-seq
MIRT1306104	hsa-miR-3908	CLIP-seq
MIRT1306105	hsa-miR-3941	CLIP-seq
MIRT1306106	hsa-miR-3942-5p	CLIP-seq
MIRT1306107	hsa-miR-4257	CLIP-seq
MIRT1306108	hsa-miR-4268	CLIP-seq
MIRT1306109	hsa-miR-4330	CLIP-seq
MIRT1306110	hsa-miR-4427	CLIP-seq
MIRT1306111	hsa-miR-4455	CLIP-seq
MIRT1306112	hsa-miR-449c	CLIP-seq
MIRT1306113	hsa-miR-4501	CLIP-seq
MIRT1306114	hsa-miR-4639-3p	CLIP-seq
MIRT1306115	hsa-miR-4653-3p	CLIP-seq
MIRT1306116	hsa-miR-4658	CLIP-seq
MIRT1306117	hsa-miR-4680-3p	CLIP-seq
MIRT1306118	hsa-miR-4703-5p	CLIP-seq
MIRT1306119	hsa-miR-4711-3p	CLIP-seq
MIRT1306120	hsa-miR-4752	CLIP-seq
MIRT1306121	hsa-miR-4764-5p	CLIP-seq
MIRT1306122	hsa-miR-4766-3p	CLIP-seq
MIRT1306123	hsa-miR-4778-3p	CLIP-seq
MIRT1306124	hsa-miR-4781-3p	CLIP-seq
MIRT1306125	hsa-miR-4789-5p	CLIP-seq
MIRT1306126	hsa-miR-4797-5p	CLIP-seq
MIRT1306127	hsa-miR-548ah	CLIP-seq
MIRT1306128	hsa-miR-548t	CLIP-seq
MIRT1306129	hsa-miR-574-5p	CLIP-seq
MIRT1306130	hsa-miR-576-5p	CLIP-seq
MIRT1306131	hsa-miR-603	CLIP-seq
MIRT1306132	hsa-miR-607	CLIP-seq
MIRT1306133	hsa-miR-609	CLIP-seq
MIRT1306134	hsa-miR-648	CLIP-seq
MIRT1306135	hsa-miR-655	CLIP-seq
MIRT1306136	hsa-miR-759	CLIP-seq
MIRT1306137	hsa-miR-877	CLIP-seq
MIRT1306138	hsa-miR-889	CLIP-seq
MIRT1306139	hsa-miR-9	CLIP-seq
MIRT1306140	hsa-miR-940	CLIP-seq
MIRT2090668	hsa-miR-1200	CLIP-seq
MIRT2090669	hsa-miR-1208	CLIP-seq
MIRT2090670	hsa-miR-1256	CLIP-seq
MIRT1306084	hsa-miR-129-5p	CLIP-seq
MIRT2090671	hsa-miR-1297	CLIP-seq
MIRT2090672	hsa-miR-1976	CLIP-seq
MIRT2090673	hsa-miR-26a	CLIP-seq
MIRT2090674	hsa-miR-26b	CLIP-seq
MIRT2090675	hsa-miR-3065-5p	CLIP-seq
MIRT2090676	hsa-miR-3157-5p	CLIP-seq
MIRT2090677	hsa-miR-3163	CLIP-seq
MIRT2090678	hsa-miR-3171	CLIP-seq
MIRT2090679	hsa-miR-335	CLIP-seq
MIRT2090680	hsa-miR-340	CLIP-seq
MIRT2090681	hsa-miR-3714	CLIP-seq
MIRT2090682	hsa-miR-3914	CLIP-seq
MIRT2090683	hsa-miR-3924	CLIP-seq
MIRT2090684	hsa-miR-421	CLIP-seq
MIRT2090685	hsa-miR-4279	CLIP-seq
MIRT2090686	hsa-miR-4324	CLIP-seq
MIRT2090687	hsa-miR-4420	CLIP-seq
MIRT1306110	hsa-miR-4427	CLIP-seq
MIRT2090688	hsa-miR-4465	CLIP-seq
MIRT1306117	hsa-miR-4680-3p	CLIP-seq
MIRT2090689	hsa-miR-4691-3p	CLIP-seq
MIRT2090690	hsa-miR-4695-3p	CLIP-seq
MIRT2090691	hsa-miR-4703-3p	CLIP-seq
MIRT2090692	hsa-miR-4709-5p	CLIP-seq
MIRT2090693	hsa-miR-4729	CLIP-seq
MIRT2090694	hsa-miR-4762-3p	CLIP-seq
MIRT2090695	hsa-miR-4796-3p	CLIP-seq
MIRT2090696	hsa-miR-498	CLIP-seq
MIRT2090697	hsa-miR-515-5p	CLIP-seq
MIRT2090698	hsa-miR-520g	CLIP-seq
MIRT2090699	hsa-miR-520h	CLIP-seq
MIRT2090700	hsa-miR-543	CLIP-seq
MIRT2090701	hsa-miR-544b	CLIP-seq
MIRT2090702	hsa-miR-548a-3p	CLIP-seq
MIRT2090703	hsa-miR-548an	CLIP-seq
MIRT2090704	hsa-miR-548e	CLIP-seq
MIRT2090705	hsa-miR-548f	CLIP-seq
MIRT2090706	hsa-miR-570	CLIP-seq
MIRT2090707	hsa-miR-582-3p	CLIP-seq
MIRT2090708	hsa-miR-668	CLIP-seq
MIRT2090709	hsa-miR-767-3p	CLIP-seq
MIRT2090710	hsa-miR-873	CLIP-seq
MIRT2315371	hsa-miR-1179	CLIP-seq
MIRT2090669	hsa-miR-1208	CLIP-seq
MIRT2090671	hsa-miR-1297	CLIP-seq
MIRT2315372	hsa-miR-1305	CLIP-seq
MIRT2315373	hsa-miR-2054	CLIP-seq
MIRT2090673	hsa-miR-26a	CLIP-seq
MIRT2090674	hsa-miR-26b	CLIP-seq
MIRT2090677	hsa-miR-3163	CLIP-seq
MIRT2090680	hsa-miR-340	CLIP-seq
MIRT2315374	hsa-miR-3647-3p	CLIP-seq
MIRT1306097	hsa-miR-3659	CLIP-seq
MIRT2315375	hsa-miR-3692	CLIP-seq
MIRT2090681	hsa-miR-3714	CLIP-seq
MIRT2315376	hsa-miR-3919	CLIP-seq
MIRT2090683	hsa-miR-3924	CLIP-seq
MIRT1306106	hsa-miR-3942-5p	CLIP-seq
MIRT2090687	hsa-miR-4420	CLIP-seq
MIRT1306111	hsa-miR-4455	CLIP-seq
MIRT2315377	hsa-miR-4459	CLIP-seq
MIRT2090688	hsa-miR-4465	CLIP-seq
MIRT2315378	hsa-miR-4484	CLIP-seq
MIRT2315379	hsa-miR-4509	CLIP-seq
MIRT1306116	hsa-miR-4658	CLIP-seq
MIRT2315380	hsa-miR-4668-3p	CLIP-seq
MIRT2315381	hsa-miR-4699-3p	CLIP-seq
MIRT1306118	hsa-miR-4703-5p	CLIP-seq
MIRT2315382	hsa-miR-4722-5p	CLIP-seq
MIRT2090693	hsa-miR-4729	CLIP-seq
MIRT2315383	hsa-miR-4766-5p	CLIP-seq
MIRT2090696	hsa-miR-498	CLIP-seq
MIRT2315384	hsa-miR-513a-5p	CLIP-seq
MIRT2090700	hsa-miR-543	CLIP-seq
MIRT2090703	hsa-miR-548an	CLIP-seq
MIRT1306129	hsa-miR-574-5p	CLIP-seq
MIRT2315385	hsa-miR-581	CLIP-seq
MIRT1306133	hsa-miR-609	CLIP-seq
MIRT1306134	hsa-miR-648	CLIP-seq
MIRT2090709	hsa-miR-767-3p	CLIP-seq
MIRT1306140	hsa-miR-940	CLIP-seq
MIRT2393740	hsa-miR-1238	CLIP-seq
MIRT2393741	hsa-miR-3124-3p	CLIP-seq
MIRT2393742	hsa-miR-3160-5p	CLIP-seq
MIRT2393743	hsa-miR-4304	CLIP-seq
MIRT2393744	hsa-miR-4449	CLIP-seq
MIRT1306111	hsa-miR-4455	CLIP-seq
MIRT2315378	hsa-miR-4484	CLIP-seq
MIRT2393745	hsa-miR-4691-5p	CLIP-seq
MIRT2090703	hsa-miR-548an	CLIP-seq
MIRT1306129	hsa-miR-574-5p	CLIP-seq
MIRT1306133	hsa-miR-609	CLIP-seq
MIRT1306134	hsa-miR-648	CLIP-seq
MIRT2458214	hsa-miR-1245b-5p	CLIP-seq
MIRT2458215	hsa-miR-185	CLIP-seq
MIRT2458216	hsa-miR-3142	CLIP-seq
MIRT2458217	hsa-miR-4306	CLIP-seq
MIRT2458218	hsa-miR-4493	CLIP-seq
MIRT2458219	hsa-miR-4644	CLIP-seq
MIRT2458220	hsa-miR-516b	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0002102	Component	Podosome	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005515	Function	Protein binding	IPI	14521508, 15350535, 16752908, 18086875, 21565175, 26598620
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IDA	26598620
GO:0005925	Component	Focal adhesion	IEA
GO:0006897	Process	Endocytosis	IBA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007010	Process	Cytoskeleton organization	IMP	21834987
GO:0007015	Process	Actin filament organization	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IMP	21834987
GO:0010008	Component	Endosome membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016601	Process	Rac protein signal transduction	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0030010	Process	Establishment of cell polarity	IBA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IMP	26598620
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0070161	Component	Anchoring junction	IEA
GO:0120183	Process	Positive regulation of focal adhesion disassembly	IMP	26598620
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24270810

MIM	HGNC	e!Ensembl
606366	17794	ENSG00000116574

Q7L0Q8

Protein name

Rho-related GTP-binding protein RhoU (CDC42-like GTPase 1) (GTP-binding protein-like 1) (Rho GTPase-like protein ARHU) (Ryu GTPase) (Wnt-1 responsive Cdc42 homolog 1) (WRCH-1)

Protein function

Binds to and activates protein kinase PAK1 (PubMed:11459829). Plays a role in the regulation of cell morphology, cytoskeletal organization and focal adhesion assembly during cell migration (PubMed:11459829, PubMed:17620058, PubMed:18086875, PubM

PDB

2Q3H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	51 → 223	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in all tissues examined. Expressed at high levels in the stomach, small intestine, brain, skeletal muscle and placenta. {ECO:0000269|PubMed:11459829, ECO:0000269|PubMed:14731133}.

Sequence

MPPQQGDPAFPDRCEAPPVPPRRERGGRGGRGPGEPGGRGRAGGAEGRGVKCVLVGDGAV
GKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTN
TDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKE
KPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSDTQQQPKKSKSRTP
DKMKNLSKSWWKKYCCFV

Sequence length

258

Interactions

View interactions

	Reactome
			Rho GTPase cycle Interleukin-4 and Interleukin-13 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (34)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinogenesis	Associate	19567454	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Inhibit	24709777	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Associate	25137373	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Associate	24709777, 25137373	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticulum	Associate	31089239	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	27196083	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	36221055	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	36221055	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Arrest	Associate	27196083	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Associate	19567454	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Inhibit	25428027	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic T Cell	Associate	28165464	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia T Cell	Associate	22349824	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Associate	28510328	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	29440639	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	27196083	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	33557409	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	21508312	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22349824	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	27196083, 32139877	★★★★★ ★☆☆☆☆ Found in Text Mining only

RHOU (ras homolog family member U)