Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	58473
Gene name Gene Name - the full gene name approved by the HGNC.	Pleckstrin homology domain containing B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PLEKHB1
Synonyms (NCBI Gene) Gene synonyms aliases	KPL1, PHR1, PHRET1
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.4

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017412	hsa-miR-335-5p	Microarray	18185580
MIRT021332	hsa-miR-9-5p	Microarray	17612493
MIRT022411	hsa-miR-124-3p	Microarray	18668037
MIRT025679	hsa-miR-7-5p	Microarray	17612493
MIRT049007	hsa-miR-92a-3p	CLASH	23622248
MIRT1241413	hsa-miR-3591-5p	CLIP-seq
MIRT1241414	hsa-miR-4300	CLIP-seq
MIRT1241415	hsa-miR-4417	CLIP-seq
MIRT1241416	hsa-miR-4460	CLIP-seq
MIRT1241417	hsa-miR-4727-3p	CLIP-seq
MIRT1241418	hsa-miR-5095	CLIP-seq
MIRT1241419	hsa-miR-920	CLIP-seq
MIRT1241420	hsa-miR-939	CLIP-seq
MIRT2298202	hsa-miR-3158-3p	CLIP-seq
MIRT2298203	hsa-miR-3160-5p	CLIP-seq
MIRT2298204	hsa-miR-3652	CLIP-seq
MIRT2298205	hsa-miR-4430	CLIP-seq
MIRT2298206	hsa-miR-4446-3p	CLIP-seq
MIRT2298207	hsa-miR-4459	CLIP-seq
MIRT2298208	hsa-miR-4492	CLIP-seq
MIRT2298209	hsa-miR-4498	CLIP-seq
MIRT2298210	hsa-miR-615-5p	CLIP-seq
MIRT2298211	hsa-miR-665	CLIP-seq
MIRT2298212	hsa-miR-762	CLIP-seq
MIRT2298202	hsa-miR-3158-3p	CLIP-seq
MIRT2298203	hsa-miR-3160-5p	CLIP-seq
MIRT2298204	hsa-miR-3652	CLIP-seq
MIRT2298205	hsa-miR-4430	CLIP-seq
MIRT2298206	hsa-miR-4446-3p	CLIP-seq
MIRT2298208	hsa-miR-4492	CLIP-seq
MIRT2298209	hsa-miR-4498	CLIP-seq
MIRT2298212	hsa-miR-762	CLIP-seq
MIRT2465859	hsa-miR-4294	CLIP-seq
MIRT2298207	hsa-miR-4459	CLIP-seq
MIRT2298210	hsa-miR-615-5p	CLIP-seq
MIRT2298211	hsa-miR-665	CLIP-seq

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	24705354, 25416956, 25814554, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0007602	Process	Phototransduction	NAS	10585447
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	10585447
GO:0016020	Component	Membrane	IEA
GO:0045595	Process	Regulation of cell differentiation	IBA

MIM	HGNC	e!Ensembl
607651	19079	ENSG00000021300

Protein

UniProt ID

Q9UF11

Protein name

Pleckstrin homology domain-containing family B member 1 (PH domain-containing family B member 1) (Evectin-1) (PH domain-containing protein in retina 1) (PHRET1) (Pleckstrin homology domain retinal protein 1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	22 → 128	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in retina and brain. Levels are very low or not detectable in all other tissues tested. {ECO:0000269|PubMed:10585447}.

Sequence

MSPAAPVPPDSALESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQ
DEEDRVLIHFNVRDIKIGPECHDVQPPEGRSRDGLLTVNLREGGRLHLCAETKDDALAWK
TALLEANSTPAPAGATVPPRSRRVCSKVRCVTRSWSPCKVERRIWVRVYSPYQDYYEVVP
PNAHEATYVRSYYGPPYAGPGVTHVIVREDPCYSAGAPLAMGMLAGAATGAALGSLMWSP
CWF

Sequence length

243

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Bladder Exstrophy	Associate	37509153
Osteoporosis	Associate	32496000

PLEKHB1 (pleckstrin homology domain containing B1)