Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	58473
Gene name Gene Name - the full gene name approved by the HGNC.	Pleckstrin homology domain containing B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PLEKHB1
Synonyms (NCBI Gene) Gene synonyms aliases	KPL1, PHR1, PHRET1
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.4

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017412	hsa-miR-335-5p	Microarray	18185580
MIRT021332	hsa-miR-9-5p	Microarray	17612493
MIRT022411	hsa-miR-124-3p	Microarray	18668037
MIRT025679	hsa-miR-7-5p	Microarray	17612493
MIRT049007	hsa-miR-92a-3p	CLASH	23622248
MIRT1241413	hsa-miR-3591-5p	CLIP-seq
MIRT1241414	hsa-miR-4300	CLIP-seq
MIRT1241415	hsa-miR-4417	CLIP-seq
MIRT1241416	hsa-miR-4460	CLIP-seq
MIRT1241417	hsa-miR-4727-3p	CLIP-seq
MIRT1241418	hsa-miR-5095	CLIP-seq
MIRT1241419	hsa-miR-920	CLIP-seq
MIRT1241420	hsa-miR-939	CLIP-seq
MIRT2298202	hsa-miR-3158-3p	CLIP-seq
MIRT2298203	hsa-miR-3160-5p	CLIP-seq
MIRT2298204	hsa-miR-3652	CLIP-seq
MIRT2298205	hsa-miR-4430	CLIP-seq
MIRT2298206	hsa-miR-4446-3p	CLIP-seq
MIRT2298207	hsa-miR-4459	CLIP-seq
MIRT2298208	hsa-miR-4492	CLIP-seq
MIRT2298209	hsa-miR-4498	CLIP-seq
MIRT2298210	hsa-miR-615-5p	CLIP-seq
MIRT2298211	hsa-miR-665	CLIP-seq
MIRT2298212	hsa-miR-762	CLIP-seq
MIRT2298202	hsa-miR-3158-3p	CLIP-seq
MIRT2298203	hsa-miR-3160-5p	CLIP-seq
MIRT2298204	hsa-miR-3652	CLIP-seq
MIRT2298205	hsa-miR-4430	CLIP-seq
MIRT2298206	hsa-miR-4446-3p	CLIP-seq
MIRT2298208	hsa-miR-4492	CLIP-seq
MIRT2298209	hsa-miR-4498	CLIP-seq
MIRT2298212	hsa-miR-762	CLIP-seq
MIRT2465859	hsa-miR-4294	CLIP-seq
MIRT2298207	hsa-miR-4459	CLIP-seq
MIRT2298210	hsa-miR-615-5p	CLIP-seq
MIRT2298211	hsa-miR-665	CLIP-seq

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005737	Component	Cytoplasm	IEA
GO:0007275	Process	Multicellular organism development	IEA
GO:0007602	Process	Phototransduction	NAS	10585447
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0016021	Component	Integral component of membrane	IDA	10585447
GO:0045595	Process	Regulation of cell differentiation	IBA	21873635

MIM	HGNC	e!Ensembl
607651	19079	ENSG00000021300

Protein

UniProt ID

Q9UF11

Protein name

Pleckstrin homology domain-containing family B member 1 (PH domain-containing family B member 1) (Evectin-1) (PH domain-containing protein in retina 1) (PHRET1) (Pleckstrin homology domain retinal protein 1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	22 → 128	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in retina and brain. Levels are very low or not detectable in all other tissues tested. {ECO:0000269|PubMed:10585447}.

Sequence

MSPAAPVPPDSALESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQ
DEEDRVLIHFNVRDIKIGPECHDVQPPEGRSRDGLLTVNLREGGRLHLCAETKDDALAWK
TALLEANSTPAPAGATVPPRSRRVCSKVRCVTRSWSPCKVERRIWVRVYSPYQDYYEVVP
PNAHEATYVRSYYGPPYAGPGVTHVIVREDPCYSAGAPLAMGMLAGAATGAALGSLMWSP
CWF

Sequence length

243

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Schizophrenia	Schizophrenia			GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Bladder Exstrophy	Associate	37509153
Osteoporosis	Associate	32496000

PLEKHB1 (pleckstrin homology domain containing B1)