Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
582
Gene name Gene Name - the full gene name approved by the HGNC.
Bardet-Biedl syndrome 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BBS1
Synonyms (NCBI Gene) Gene synonyms aliases
BBS2L2
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
Mutations in this gene have been observed in patients with the major form (type 1) of Bardet-Biedl syndrome. The encoded protein may play a role in eye, limb, cardiac and reproductive system development. [provided by RefSeq, Jul 2008]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs113994178 AAGATGGCCGCTGCGTCCTCATCGGATTCCGACGCCTGCG>- Pathogenic 5 prime UTR variant, frameshift variant, initiator codon variant
rs146052054 T>G Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, missense variant
rs200688985 G>A Likely-pathogenic Coding sequence variant, missense variant
rs376894444 G>A Pathogenic-likely-pathogenic, likely-pathogenic Missense variant, coding sequence variant
rs587777829 G>A Pathogenic, likely-pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT626384 hsa-miR-3692-5p HITS-CLIP 23824327
MIRT626383 hsa-miR-6861-5p HITS-CLIP 23824327
MIRT626382 hsa-miR-5002-3p HITS-CLIP 23824327
MIRT626381 hsa-miR-4731-5p HITS-CLIP 23824327
MIRT626380 hsa-miR-5589-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000226 Process Microtubule cytoskeleton organization IEA
GO:0001764 Process Neuron migration IEA
GO:0001895 Process Retina homeostasis IEA
GO:0001895 Process Retina homeostasis IEA
GO:0005102 Function Signaling receptor binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
209901 966 ENSG00000174483
Protein
UniProt ID Q8NFJ9
Protein name BBSome complex member BBS1 (BBS2-like protein 2) (Bardet-Biedl syndrome 1 protein)
Protein function The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This cilio
PDB 6XT9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14779 BBS1 23 276 Ciliary BBSome complex subunit 1 Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in the kidney. Also found in fetal tissue, testis, retina, adipose tissue, heart, skeletal muscle and pancreas.
Sequence
MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLG
PGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRP
YFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELS
EMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILA
KMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILR
RDSKHPKYCIELSAQPVGLIRVHK
VLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRD
KALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPA
QAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLST
TAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLL
VPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA
Sequence length 593
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    BBSome-mediated cargo-targeting to cilium
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Bardet-Biedl Syndrome Bardet-Biedl syndrome 1, bardet-biedl syndrome rs863224782, rs1590762360, rs1555050394, rs1555049893, rs1057516661, rs1060503690, rs1057516507, rs1856790811, rs1565289799, rs786204444, rs1555047409, rs1057516330, rs869025204, rs1014835928, rs1555050268
View all (61 more)
N/A
retinal dystrophy Retinal dystrophy rs772917364, rs1856202628, rs786204444, rs786204701, rs1166022838, rs1057516451, rs1856699646, rs745656125, rs794727006, rs376894444, rs1856478505, rs1856787758, rs746875134, rs1856790811, rs113624356 N/A
Retinitis Pigmentosa retinitis pigmentosa rs113624356, rs1856758582, rs762276925, rs121917777, rs1160669210, rs1555050487, rs376894444, rs1555049194 N/A
Usher Syndrome usher syndrome rs113624356 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Albinism Associate 39596324
Asperger Syndrome Associate 22940089
Atrophy Associate 22940089
Bardet Biedl Syndrome Associate 10577922, 12016587, 12567324, 12677556, 15666242, 17980398, 20177705, 21052717, 21209035, 22773737, 22940089, 22998390, 23559858, 24611735, 25402481
View all (15 more)
Cardiovascular Diseases Associate 24611735
Chronic Kidney Disease Mineral and Bone Disorder Associate 27659767
Ciliopathies Associate 35764379, 39596324
Cone Rod Dystrophies Associate 34940782
Cranioectodermal Dysplasia Associate 33369054
Depressive Disorder Associate 22940089