Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	58191
Gene name	C-X-C motif chemokine ligand 16
Gene symbol	CXCL16
Synonyms (NCBI Gene)	CXCLG16SR-PSOXSRPSOX
Chromosome	17
Chromosome location	17p13.2

253

Show/Hide all (253)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019098	hsa-miR-335-5p	Microarray	18185580
MIRT049831	hsa-miR-92a-3p	CLASH	23622248
MIRT037621	hsa-miR-744-5p	CLASH	23622248
MIRT460129	hsa-miR-490-3p	PAR-CLIP	23592263
MIRT460128	hsa-miR-7851-3p	PAR-CLIP	23592263
MIRT460127	hsa-miR-5694	PAR-CLIP	23592263
MIRT460126	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT460125	hsa-miR-1273f	PAR-CLIP	23592263
MIRT460124	hsa-miR-4537	PAR-CLIP	23592263
MIRT460123	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT460122	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT460121	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT460120	hsa-miR-8085	PAR-CLIP	23592263
MIRT460119	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT460118	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT460117	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT460116	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT460115	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT460114	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT460113	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT460112	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT460111	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT460110	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT460109	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT460108	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT460129	hsa-miR-490-3p	PAR-CLIP	23592263
MIRT460128	hsa-miR-7851-3p	PAR-CLIP	23592263
MIRT460127	hsa-miR-5694	PAR-CLIP	23592263
MIRT460126	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT460125	hsa-miR-1273f	PAR-CLIP	23592263
MIRT460124	hsa-miR-4537	PAR-CLIP	23592263
MIRT460123	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT460122	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT460121	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT460120	hsa-miR-8085	PAR-CLIP	23592263
MIRT460119	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT460118	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT460117	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT460116	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT460115	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT460114	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT460113	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT460112	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT460111	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT460110	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT460109	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT460108	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT917952	hsa-miR-100	CLIP-seq
MIRT917953	hsa-miR-1226	CLIP-seq
MIRT917954	hsa-miR-1254	CLIP-seq
MIRT917955	hsa-miR-1255a	CLIP-seq
MIRT917956	hsa-miR-1255b	CLIP-seq
MIRT917957	hsa-miR-1275	CLIP-seq
MIRT917958	hsa-miR-128	CLIP-seq
MIRT917959	hsa-miR-1286	CLIP-seq
MIRT917960	hsa-miR-1293	CLIP-seq
MIRT917961	hsa-miR-1323	CLIP-seq
MIRT917962	hsa-miR-1827	CLIP-seq
MIRT917963	hsa-miR-185	CLIP-seq
MIRT917964	hsa-miR-199a-5p	CLIP-seq
MIRT917965	hsa-miR-199b-5p	CLIP-seq
MIRT917966	hsa-miR-2114	CLIP-seq
MIRT917967	hsa-miR-27a	CLIP-seq
MIRT917968	hsa-miR-27b	CLIP-seq
MIRT917969	hsa-miR-3116	CLIP-seq
MIRT917970	hsa-miR-3130-5p	CLIP-seq
MIRT917971	hsa-miR-3150b-3p	CLIP-seq
MIRT917972	hsa-miR-3184	CLIP-seq
MIRT917973	hsa-miR-3192	CLIP-seq
MIRT917974	hsa-miR-3199	CLIP-seq
MIRT917975	hsa-miR-323-5p	CLIP-seq
MIRT917976	hsa-miR-330-3p	CLIP-seq
MIRT917977	hsa-miR-3605-5p	CLIP-seq
MIRT917978	hsa-miR-3612	CLIP-seq
MIRT917979	hsa-miR-3613-3p	CLIP-seq
MIRT917980	hsa-miR-3646	CLIP-seq
MIRT917981	hsa-miR-3657	CLIP-seq
MIRT917982	hsa-miR-3662	CLIP-seq
MIRT917983	hsa-miR-3663-3p	CLIP-seq
MIRT917984	hsa-miR-3664-3p	CLIP-seq
MIRT917985	hsa-miR-3689a-3p	CLIP-seq
MIRT917986	hsa-miR-3689c	CLIP-seq
MIRT917987	hsa-miR-3689d	CLIP-seq
MIRT917988	hsa-miR-3691-3p	CLIP-seq
MIRT917989	hsa-miR-371-5p	CLIP-seq
MIRT917990	hsa-miR-371b-5p	CLIP-seq
MIRT917991	hsa-miR-383	CLIP-seq
MIRT917992	hsa-miR-3928	CLIP-seq
MIRT917993	hsa-miR-423-5p	CLIP-seq
MIRT917994	hsa-miR-4302	CLIP-seq
MIRT917995	hsa-miR-4306	CLIP-seq
MIRT917996	hsa-miR-4433	CLIP-seq
MIRT917997	hsa-miR-4446-3p	CLIP-seq
MIRT917998	hsa-miR-4447	CLIP-seq
MIRT917999	hsa-miR-4455	CLIP-seq
MIRT918000	hsa-miR-4459	CLIP-seq
MIRT918001	hsa-miR-4472	CLIP-seq
MIRT918002	hsa-miR-4475	CLIP-seq
MIRT918003	hsa-miR-4482	CLIP-seq
MIRT918004	hsa-miR-4483	CLIP-seq
MIRT918005	hsa-miR-4494	CLIP-seq
MIRT918006	hsa-miR-451	CLIP-seq
MIRT918007	hsa-miR-4525	CLIP-seq
MIRT918008	hsa-miR-4644	CLIP-seq
MIRT918009	hsa-miR-4649-3p	CLIP-seq
MIRT918010	hsa-miR-4656	CLIP-seq
MIRT918011	hsa-miR-4665-5p	CLIP-seq
MIRT918012	hsa-miR-4689	CLIP-seq
MIRT918013	hsa-miR-4695-5p	CLIP-seq
MIRT918014	hsa-miR-4710	CLIP-seq
MIRT918015	hsa-miR-4721	CLIP-seq
MIRT918016	hsa-miR-4722-5p	CLIP-seq
MIRT918017	hsa-miR-4723-5p	CLIP-seq
MIRT918018	hsa-miR-4728-5p	CLIP-seq
MIRT918019	hsa-miR-4733-3p	CLIP-seq
MIRT918020	hsa-miR-4740-5p	CLIP-seq
MIRT918021	hsa-miR-4768-3p	CLIP-seq
MIRT918022	hsa-miR-4784	CLIP-seq
MIRT918023	hsa-miR-4786-3p	CLIP-seq
MIRT918024	hsa-miR-4786-5p	CLIP-seq
MIRT918025	hsa-miR-4792	CLIP-seq
MIRT918026	hsa-miR-4795-3p	CLIP-seq
MIRT918027	hsa-miR-499a-5p	CLIP-seq
MIRT918028	hsa-miR-505	CLIP-seq
MIRT918029	hsa-miR-508-5p	CLIP-seq
MIRT918030	hsa-miR-510	CLIP-seq
MIRT918031	hsa-miR-512-5p	CLIP-seq
MIRT918032	hsa-miR-541	CLIP-seq
MIRT918033	hsa-miR-545	CLIP-seq
MIRT918034	hsa-miR-548o	CLIP-seq
MIRT918035	hsa-miR-548p	CLIP-seq
MIRT918036	hsa-miR-582-3p	CLIP-seq
MIRT918037	hsa-miR-587	CLIP-seq
MIRT918038	hsa-miR-625	CLIP-seq
MIRT918039	hsa-miR-650	CLIP-seq
MIRT918040	hsa-miR-654-5p	CLIP-seq
MIRT918041	hsa-miR-661	CLIP-seq
MIRT918042	hsa-miR-765	CLIP-seq
MIRT918043	hsa-miR-766	CLIP-seq
MIRT918044	hsa-miR-876-3p	CLIP-seq
MIRT918045	hsa-miR-940	CLIP-seq
MIRT918046	hsa-miR-99a	CLIP-seq
MIRT918047	hsa-miR-99b	CLIP-seq
MIRT917958	hsa-miR-128	CLIP-seq
MIRT1972107	hsa-miR-1285	CLIP-seq
MIRT917967	hsa-miR-27a	CLIP-seq
MIRT917968	hsa-miR-27b	CLIP-seq
MIRT1972108	hsa-miR-3122	CLIP-seq
MIRT1972109	hsa-miR-3173-3p	CLIP-seq
MIRT1972110	hsa-miR-3187-5p	CLIP-seq
MIRT917973	hsa-miR-3192	CLIP-seq
MIRT917984	hsa-miR-3664-3p	CLIP-seq
MIRT917985	hsa-miR-3689a-3p	CLIP-seq
MIRT917986	hsa-miR-3689c	CLIP-seq
MIRT1972111	hsa-miR-376c	CLIP-seq
MIRT917991	hsa-miR-383	CLIP-seq
MIRT1972112	hsa-miR-3913-5p	CLIP-seq
MIRT1972113	hsa-miR-4428	CLIP-seq
MIRT917996	hsa-miR-4433	CLIP-seq
MIRT917997	hsa-miR-4446-3p	CLIP-seq
MIRT918000	hsa-miR-4459	CLIP-seq
MIRT918005	hsa-miR-4494	CLIP-seq
MIRT1972114	hsa-miR-4521	CLIP-seq
MIRT1972115	hsa-miR-4639-5p	CLIP-seq
MIRT918018	hsa-miR-4728-5p	CLIP-seq
MIRT918021	hsa-miR-4768-3p	CLIP-seq
MIRT1972116	hsa-miR-4779	CLIP-seq
MIRT918024	hsa-miR-4786-5p	CLIP-seq
MIRT918027	hsa-miR-499a-5p	CLIP-seq
MIRT918028	hsa-miR-505	CLIP-seq
MIRT918030	hsa-miR-510	CLIP-seq
MIRT918037	hsa-miR-587	CLIP-seq
MIRT1972117	hsa-miR-612	CLIP-seq
MIRT918041	hsa-miR-661	CLIP-seq
MIRT2207923	hsa-miR-1228	CLIP-seq
MIRT917958	hsa-miR-128	CLIP-seq
MIRT917960	hsa-miR-1293	CLIP-seq
MIRT917967	hsa-miR-27a	CLIP-seq
MIRT917968	hsa-miR-27b	CLIP-seq
MIRT1972108	hsa-miR-3122	CLIP-seq
MIRT917973	hsa-miR-3192	CLIP-seq
MIRT2207924	hsa-miR-342-3p	CLIP-seq
MIRT917985	hsa-miR-3689a-3p	CLIP-seq
MIRT917986	hsa-miR-3689c	CLIP-seq
MIRT1972112	hsa-miR-3913-5p	CLIP-seq
MIRT2207925	hsa-miR-4252	CLIP-seq
MIRT2207926	hsa-miR-4284	CLIP-seq
MIRT917997	hsa-miR-4446-3p	CLIP-seq
MIRT918004	hsa-miR-4483	CLIP-seq
MIRT918018	hsa-miR-4728-5p	CLIP-seq
MIRT918032	hsa-miR-541	CLIP-seq
MIRT918040	hsa-miR-654-5p	CLIP-seq
MIRT918041	hsa-miR-661	CLIP-seq
MIRT2447846	hsa-miR-186	CLIP-seq
MIRT2447847	hsa-miR-3133	CLIP-seq
MIRT917975	hsa-miR-323-5p	CLIP-seq
MIRT917979	hsa-miR-3613-3p	CLIP-seq
MIRT917983	hsa-miR-3663-3p	CLIP-seq
MIRT2447848	hsa-miR-4432	CLIP-seq
MIRT917999	hsa-miR-4455	CLIP-seq
MIRT2447849	hsa-miR-4684-5p	CLIP-seq
MIRT918014	hsa-miR-4710	CLIP-seq
MIRT918025	hsa-miR-4792	CLIP-seq
MIRT2447850	hsa-miR-548c-3p	CLIP-seq
MIRT918037	hsa-miR-587	CLIP-seq
MIRT918041	hsa-miR-661	CLIP-seq
MIRT918044	hsa-miR-876-3p	CLIP-seq
MIRT2447846	hsa-miR-186	CLIP-seq
MIRT2447847	hsa-miR-3133	CLIP-seq
MIRT2447848	hsa-miR-4432	CLIP-seq
MIRT918037	hsa-miR-587	CLIP-seq
MIRT2207923	hsa-miR-1228	CLIP-seq
MIRT917954	hsa-miR-1254	CLIP-seq
MIRT917955	hsa-miR-1255a	CLIP-seq
MIRT917956	hsa-miR-1255b	CLIP-seq
MIRT917960	hsa-miR-1293	CLIP-seq
MIRT917969	hsa-miR-3116	CLIP-seq
MIRT1972108	hsa-miR-3122	CLIP-seq
MIRT917975	hsa-miR-323-5p	CLIP-seq
MIRT917979	hsa-miR-3613-3p	CLIP-seq
MIRT917983	hsa-miR-3663-3p	CLIP-seq
MIRT917985	hsa-miR-3689a-3p	CLIP-seq
MIRT917986	hsa-miR-3689c	CLIP-seq
MIRT1972112	hsa-miR-3913-5p	CLIP-seq
MIRT2207925	hsa-miR-4252	CLIP-seq
MIRT917996	hsa-miR-4433	CLIP-seq
MIRT917999	hsa-miR-4455	CLIP-seq
MIRT918000	hsa-miR-4459	CLIP-seq
MIRT918004	hsa-miR-4483	CLIP-seq
MIRT2447849	hsa-miR-4684-5p	CLIP-seq
MIRT918014	hsa-miR-4710	CLIP-seq
MIRT918018	hsa-miR-4728-5p	CLIP-seq
MIRT918021	hsa-miR-4768-3p	CLIP-seq
MIRT918024	hsa-miR-4786-5p	CLIP-seq
MIRT918025	hsa-miR-4792	CLIP-seq
MIRT2511254	hsa-miR-4793-3p	CLIP-seq
MIRT918028	hsa-miR-505	CLIP-seq
MIRT918029	hsa-miR-508-5p	CLIP-seq
MIRT918032	hsa-miR-541	CLIP-seq
MIRT2447850	hsa-miR-548c-3p	CLIP-seq
MIRT918040	hsa-miR-654-5p	CLIP-seq
MIRT918041	hsa-miR-661	CLIP-seq
MIRT918043	hsa-miR-766	CLIP-seq
MIRT918044	hsa-miR-876-3p	CLIP-seq
MIRT917975	hsa-miR-323-5p	CLIP-seq
MIRT917979	hsa-miR-3613-3p	CLIP-seq
MIRT917983	hsa-miR-3663-3p	CLIP-seq
MIRT917999	hsa-miR-4455	CLIP-seq
MIRT2447849	hsa-miR-4684-5p	CLIP-seq
MIRT918014	hsa-miR-4710	CLIP-seq
MIRT918025	hsa-miR-4792	CLIP-seq
MIRT2447850	hsa-miR-548c-3p	CLIP-seq
MIRT918044	hsa-miR-876-3p	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IBA
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IEA
GO:0005041	Function	Low-density lipoprotein particle receptor activity	ISS
GO:0005044	Function	Scavenger receptor activity	IBA
GO:0005044	Function	Scavenger receptor activity	IEA
GO:0005044	Function	Scavenger receptor activity	TAS	11060282
GO:0005125	Function	Cytokine activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18373975
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	NAS	11060282
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	NAS	11290797
GO:0007165	Process	Signal transduction	IEA
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	18373975
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	ISS
GO:0010818	Process	T cell chemotaxis	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11290797
GO:0016020	Component	Membrane	TAS	11060282
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030307	Process	Positive regulation of cell growth	IMP	18373975
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	18373975
GO:0034097	Process	Response to cytokine	IDA	18373975
GO:0034097	Process	Response to cytokine	IEA
GO:0034341	Process	Response to type II interferon	IDA	18373975
GO:0034341	Process	Response to type II interferon	IEA
GO:0034612	Process	Response to tumor necrosis factor	IDA	18373975
GO:0034612	Process	Response to tumor necrosis factor	IEA
GO:0048247	Process	Lymphocyte chemotaxis	IEA

MIM	HGNC	e!Ensembl
605398	16642	ENSG00000161921

Q9H2A7

Protein name

C-X-C motif chemokine 16 (Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein) (SR-PSOX) (Small-inducible cytokine B16) (Transmembrane chemokine CXCL16)

Protein function

Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.

Sequence

MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRK
HLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTS
PPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLA
AGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPD
LPVHYIPVAPDSNT

Sequence length

254

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Chemokine signaling pathway		Chemokine receptors bind chemokines G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (111)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Aortic Aneurysm Familial Abdominal 1	Stimulate	25548922	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Associate	35865542	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Associate	35055107, 35784287	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Stimulate	15880344, 24000379, 34271942	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	32365786, 33633196	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	15836657, 17342260, 19494317, 21492481, 25142184, 27877078, 28286356	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Stimulate	36232370	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Associate	28698473	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	25909173, 36950218	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Stimulate	36938723	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	25888629, 26021984	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Stimulate	21527066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	18195710, 28759013	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Associate	33637127	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	35784287	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Associate	25142184	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Stimulate	32180680	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cell Transformation Neoplastic	Associate	19690611	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Associate	27344170	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	36246978	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	17510400, 30847498, 31752131	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Inhibit	26258407	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Associate	22454615	★★★★★ ★☆☆☆☆ Found in Text Mining only
Constriction Pathologic	Associate	15836657	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	15836657, 36232370	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Stimulate	38357816	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Associate	26045830	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Associate	15836657	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Stimulate	35121493	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cytokine Release Syndrome	Stimulate	18344492	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death	Stimulate	21303517	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Associate	28856928	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Associate	24513807	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Associate	28856928	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Stimulate	24513807	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies Myoclonic	Associate	27344170	★★★★★ ★☆☆☆☆ Found in Text Mining only
Farber Lipogranulomatosis	Associate	25888629	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Stimulate	36922030	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	28698473, 32346064, 38299146	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	28698473, 35896732	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Associate	19435795	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Stimulate	27122966	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Associate	26044615	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Stimulate	31652598	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heredodegenerative Disorders Nervous System	Associate	27344170	★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis Langerhans Cell	Associate	36714021	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	34011069	★★★★★ ★☆☆☆☆ Found in Text Mining only
IgA Vasculitis	Associate	15880344	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Associate	35865542	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Stimulate	27095254, 34256007	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	15880344, 17342260, 19690611, 21527066, 22958742, 24513807, 26272362, 27122966, 27877078, 28246376, 28856928, 29353287, 33633196, 33637127, 36879307	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	38357816	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Associate	38044363	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Stimulate	24667736	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	19435795	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Associate	27877078	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	38172124	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Associate	15634930, 34367180	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Associate	15634930	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Stimulate	36922030	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Associate	37587067	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Injury	Associate	36922030	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	24897301, 29327939, 29353287	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Stimulate	25888629, 27095254	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Stimulate	31019506	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	21527066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	29353287	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Associate	30894217	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	28698473	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Stimulate	35784287	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Associate	35865542	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Associate	32617116	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Associate	33082496, 38357816	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	28286356, 33637127	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathies Structural Congenital	Associate	37272931	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	22226739	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	18452560, 21527066, 26272362	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	17510400, 18344492, 19690611, 21527066, 22226739, 22958742, 25712684, 26021984, 26272362, 26796342, 28759013, 29353287, 29440463, 34247149, 35562947, 39815613 View all (1 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	30024813, 34517533	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	31752131	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Cystic Mucinous and Serous	Associate	30792527	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Stimulate	35514316	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	38044363	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	36879307	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	25391425	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	21527066, 24518602, 25712684, 30792527, 37272931	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Associate	17459077	★★★★★ ★☆☆☆☆ Found in Text Mining only
Personality Disorders	Associate	30792527	★★★★★ ★☆☆☆☆ Found in Text Mining only
Philadelphia Chromosome	Associate	38172124	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post Acute COVID 19 Syndrome	Associate	36922030	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre Eclampsia	Associate	28856928	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Immunodeficiency Diseases	Stimulate	26345917	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	18344492, 18452560, 19690611, 22958742, 26272362, 26799186, 30974114	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	28942364, 35784287	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Stimulate	21303517	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	29725270	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Stimulate	24903614, 25501066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Associate	27095254	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Associate	21303517, 37587067	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Associate	20960183, 27095254	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	39815613	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	26708384, 35261108	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Associate	24903614	★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndrome	Associate	26345917	★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Associate	35172901	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Associate	36232370	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	36950218	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	34517533	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Associate	22958742	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	22958742	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Associate	27826097, 32532953	★★★★★ ★☆☆☆☆ Found in Text Mining only

CXCL16 (C-X-C motif chemokine ligand 16)