WFDC1 (WAP four-disulfide core domain 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 58189
Gene name WAP four-disulfide core domain 1
Gene symbol WFDC1
Synonyms (NCBI Gene)
PS20
Chromosome 16
Chromosome location 16q24.1
Summary This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family me
miRNA miRNA information provided by mirtarbase database.
5
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (5)
miRTarBase ID miRNA Experiments Reference
MIRT1492337 hsa-miR-3926 CLIP-seq
MIRT1492338 hsa-miR-4505 CLIP-seq
MIRT1492339 hsa-miR-4640-5p CLIP-seq
MIRT1492340 hsa-miR-4726-5p CLIP-seq
MIRT2368867 hsa-miR-558 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (9)
GO ID Ontology Definition Evidence Reference
GO:0001558 Process Regulation of cell growth IBA
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005615 Component Extracellular space NAS 10967136
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
605322 15466 ENSG00000103175
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HC57
Protein name WAP four-disulfide core domain protein 1 (Prostate stromal protein ps20) (ps20 growth inhibitor)
Protein function Has growth inhibitory activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00095 WAP 62 → 107 Domain
Sequence 
MPLTGVGPGSCRRQIIRALCLLLLLLHAGSAKNIWKRALPARLAEKSRAEEAGAPGGPRQ
PRADRCPPPPRTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQP
KPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQC
VKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ
Sequence length 220
Interactions View interactions