WFDC1 (WAP four-disulfide core domain 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
58189
Gene name Gene Name - the full gene name approved by the HGNC.
WAP four-disulfide core domain 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WFDC1
Synonyms (NCBI Gene) Gene synonyms aliases
PS20
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family me
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
miRTarBase ID miRNA Experiments Reference
MIRT1492337 hsa-miR-3926 CLIP-seq
MIRT1492338 hsa-miR-4505 CLIP-seq
MIRT1492339 hsa-miR-4640-5p CLIP-seq
MIRT1492340 hsa-miR-4726-5p CLIP-seq
MIRT2368867 hsa-miR-558 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
GO ID Ontology Definition Evidence Reference
GO:0001558 Process Regulation of cell growth IBA 21873635
GO:0003674 Function Molecular_function ND
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
GO:0005615 Component Extracellular space IBA 21873635
GO:0005615 Component Extracellular space NAS 10967136
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605322 15466 ENSG00000103175
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9HC57
Protein name WAP four-disulfide core domain protein 1 (Prostate stromal protein ps20) (ps20 growth inhibitor)
Protein function Has growth inhibitory activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00095 WAP 62 → 107 Domain
Sequence 
MPLTGVGPGSCRRQIIRALCLLLLLLHAGSAKNIWKRALPARLAEKSRAEEAGAPGGPRQ
PRADRCPPPPRTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQP
KPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQC
VKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ
Sequence length 220
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)		 17145863
Show/Hide Text Mining Associations (9)
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 20090771
Carcinogenesis Associate 18842679
Fibrosarcoma Inhibit 18842679
HIV Infections Associate 17942534
HTLV I Infections Associate 17942534
Infections Associate 17942534
Neoplasms Inhibit 18842679, 27115470
Prostatic Neoplasms Inhibit 27115470
Urinary Bladder Neoplasms Inhibit 18842679